KEGG   Cajanus cajan (pigeon pea): 109798463Help
Entry
109798463         CDS       T04868                                 

Definition
(RefSeq) polyamine oxidase 1-like
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00330  Arginine and proline metabolism
ccaj00410  beta-Alanine metabolism
ccaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    109798463
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109798463
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     109798463
    1.5.3.16  spermine oxidase
     109798463
    1.5.3.-  
     109798463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 Pyr_redox_2 Pyr_redox_3 FAD_binding_3 GIDA Pyr_redox FAD_binding_2 NAD_binding_9 FAD_oxidored HI0933_like Shikimate_DH FMO-like ThiF AlaDh_PNT_C TrkA_N
Motif
Other DBs
NCBI-GeneID: 109798463
NCBI-ProteinID: XP_020214360
Position
4
AA seq 479 aa AA seqDB search
MDSPSRSSVIIVGAGVSGISAAKVLAENGVKDIVILEASDRIGGRIRKENFGGFSVELGA
GWIVGVGGKESNPVWELAAESGLRTCFSDYSNARYNIYDRSGKIFPSEIAADSYRKAVNS
AIQNLNNQETDRRADSSKITESESPLTPLELAIDFILHDFEMAEVEPISTFTDFGEREYL
VADERGYDYLLYKIAEDFLFTSEGRIMDSRLKLNQVVREIQHSGSGVTVITEDDCIYEAN
YVILSVSIGVLQSDLVAFNPPLPIWKLKAIQKCDVMVYTKIFLKFPYKFWPIGPGKEFFI
YAHEQRGYYTFWQQMENAYPGSNILVVTLTNGESKRVEAQSDENTLREAMEVLRDIFGSN
IPDAIDILVPRWWNDRFQRGSYSNYPIISNPQVVRDMKAPVGRVFFTGEHTSERFNGYVH
GGYLAGIDSSKELLEEMRKDDRENESKTLLLEPMLALTECKIPGQLYLRGKLGMAEAKL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggattctccctctcgctcctccgtcatcatcgtcggtgccggtgtctccggtatctcc
gcggcgaaggtactggccgagaacggcgtaaaggacatcgtaatcctcgaggcttcagac
cgcatcggcggcaggatccgaaaggaaaacttcggcggcttctccgtcgagctcggtgct
ggttggatcgtcggagtcggcggcaaagagtccaatcctgtttgggaactcgccgccgaa
tccggcctccgaacctgcttctccgactacagcaatgcgcgatacaacatctacgaccgc
agtgggaagatatttccgagtgaaattgctgcggactcgtatagaaaagccgtgaactcg
gcaattcagaacttaaataaccaggaaactgatcgaagagccgatagctccaaaataacc
gaatcggaatcacctttgacgccgttagagctagcaattgatttcatcctccatgatttt
gaaatggcagaggtagaaccaatatctacatttacagactttggcgaaagggaatatttg
gtggcggatgaaagaggttatgattatttgctatataaaattgcagaagattttctgttt
acatctgagggtagaataatggacagtcgtctcaaacttaaccaggtcgtccgggaaata
cagcattcaggaagtggcgttacggtgataaccgaggatgattgcatctacgaagcaaat
tacgtaattctttctgttagcattggcgttctccagagcgacctcgttgccttcaatcca
cccctgcctatatggaaattgaaagcaatacagaagtgtgatgtaatggtgtacactaaa
attttcctgaagtttccatacaagttctggccaattggacccggaaaggaattcttcata
tatgctcacgaacagagaggctactacacattttggcagcaaatggagaatgcataccct
ggctctaatatcttggttgtgacgttgacaaatggggaatcaaaacgtgtggaagctcaa
tcggatgaaaacaccttgagagaagctatggaggttctcagggatatatttggatcaaac
atacccgatgccattgatatactagttccccgatggtggaatgacaggttccaacgtggc
agctacagcaactatcccattatctctaatccccaagtagttcgtgatatgaaggctcca
gtaggtcgcgttttctttaccggagagcacacaagtgaaagatttaacggctacgtacat
ggtggataccttgcaggtattgattctagcaaagagttactagaagaaatgagaaaggac
gacagagaaaatgagagcaaaactctactattagagcccatgctagcattgaccgaatgc
aaaattcctggacaattatatctcaggggcaagcttgggatggcagaggccaaattatga

DBGET integrated database retrieval system