KEGG   Cajanus cajan (pigeon pea): 109801212Help
Entry
109801212         CDS       T04868                                 

Definition
(RefSeq) protein S-acyltransferase 10-like
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
ccaj  Cajanus cajan (pigeon pea)
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109801212
Enzymes [BR:ccaj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     109801212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 109801212
NCBI-ProteinID: XP_020217815
Position
6
AA seq 249 aa AA seqDB search
MMVINERNVVYRKEPEASNQPASSRNGSFVVSMEGNQMGRYGSGSNATSWSKLVADLYPF
GSTIRTWTCTYCNVEQPPRAKHCHDCDKCVLQFDHHCVWLGNCIGQGNHCRFWWYLFEET
ALCLWTGVLYISYLKAHITRVWWQDAITILLLITLSMCLVFLLLLLLVHSYLILTNQTTY
ELVRRRRIPYLRSIPERVHPFSKGICGNLYNFCCARSSIYSLEPLPTSQEIEEKSRPYTC
LDVINCRCC
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgatggttattaacgagagaaatgtagtatacagaaaggaaccggaggcatcaaatcaa
ccagcgtcgagcagaaatgggagctttgttgtttccatggagggaaatcagatgggaaga
tatggttcaggaagcaatgcaacatcttggtcaaagttggtggctgacttgtatcctttt
gggtcaacaatcagaacatggacatgcacctactgcaatgtggagcagcctccacgagca
aagcattgtcatgactgtgacaagtgtgttcttcagtttgatcatcattgtgtttggctt
ggtaactgcattggccagggtaatcactgtcgattttggtggtacctttttgaagagaca
gcattgtgcctttggactggtgtcttgtatatttcatacctgaaggctcacattacaagg
gtttggtggcaggatgcaatcacaatactactattgattactctttcaatgtgtcttgtc
tttctgctcctcctactgctagttcatagttatcttattttgacaaatcagactacctat
gaacttgtaaggagaagacggattccttacctaaggtcaattccagaaagagtgcatcca
ttcagcaaaggaatttgtggaaatttatacaacttctgctgtgccaggagcagcatatac
agtttagaaccactgcctacctctcaagagatagaggaaaagtcaaggccatatacatgc
ttggatgtcattaattgtcgatgttgctga

DBGET integrated database retrieval system