KEGG   Cajanus cajan (pigeon pea): 109801265Help
Entry
109801265         CDS       T04868                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like isoform X1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00052  Galactose metabolism
ccaj00500  Starch and sucrose metabolism
ccaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    109801265
   00500 Starch and sucrose metabolism
    109801265
Enzymes [BR:ccaj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     109801265
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 109801265
NCBI-ProteinID: XP_020217881
Position
6
AA seq 637 aa AA seqDB search
MVIPIPSSASDSELPCSYIPVADGPHSHSGAEPRPRLKKGVFVISCGLLLLFLSLFAFFN
GQTQTLPNVSTWQPLSRGVSSGVSEKSTSLLNAYPWNNTMLSWQRTAYHFQPQNNWMNDP
NGPLYYRGWYHFFYQYNPKGAVWGDVIVWGHAVSRDLIHWLHLPLAMVADQWYDKNGVWT
GSATILPDGQVIMLYTGSTNESVQVQNLAYPADPSDPLLVDWIKYPSNPVLFPPPGIGAK
DFRDPTTAWLTSQGKWRITIGSKLNKTGIALVYDTIDFKTYERVEGLLHAVPGTGMWECV
DFFPVSNKSESGLDTSINGENVKHVVKVSLDDDRHDYYALGSYDEKNVKFTPDDSKNDVG
IGLRYDYGIFYASKTFYDQSKGRRVLWGWIGESDSEYADVAKGWASVQGIPRTVTLDQKT
GSNLLQWPVAEVESLRLRSDEFENLTVKPGSAVPLEIGTAAQLDIVAEFEIDKEALEKTV
ESNMEYKCSTSGGAAERGALGPFGLLVLADDDLSEYTPTYFYVVKGSDGHLKTFFCSDQS
RSSLANDVGKKIFGSFVPVLKDEKLSVRILVDHSIVESFAQGGRTCVTSRVYPTRAIYGA
ARLFLFNNATEGTVTASLKVWQMNSAFIRPYHPDQRN
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggtaatcccaatcccctcctcagcctctgattctgaactcccttgttcttacattccc
gtagccgatggacctcactcacactcaggcgccgagcctcggccacggctgaagaagggg
gtgtttgtcatctcttgtgggttgctgctgctgtttctctccttgttcgccttcttcaat
ggccaaacccaaacactacccaatgtgtcaacatggcaacccctttcacgtggcgtgtct
tcaggggtctccgagaagtccacctcgctactcaacgcctatccatggaacaataccatg
ctctcatggcagagaaccgcttaccacttccaacctcaaaacaattggatgaacgatcct
aatggtccattgtactacagagggtggtatcatttcttctaccagtacaatccaaagggt
gcagtttggggtgacgtcatagtttggggacacgctgtatcaagagacttgatccactgg
ctccaccttccactagcaatggtggcagatcaatggtatgataaaaacggtgtgtggact
ggctctgccaccatcttacccgatggtcaagtcatcatgttatacactggttccaccaac
gagtcagtgcaggtgcaaaaccttgcataccctgcagacccctctgatcctctcctcgtt
gattggatcaaatacccttcaaaccctgttctgtttccaccaccaggcattggtgccaaa
gattttcgtgaccccaccactgcttggctcacctctcaaggaaagtggcgcataaccatt
ggctctaagctcaacaaaactggcattgccttagtttatgacaccattgacttcaagacc
tacgagcgagtggaggggctgcttcatgcagtgcctggcactggcatgtgggagtgtgtt
gactttttccctgtttctaacaagagtgaaagtggattggatacttcaatcaatggggag
aatgtgaagcatgtggtcaaggttagcttggatgatgatagacatgattactatgcatta
gggagttatgatgagaagaatgttaagttcacaccagatgactccaagaacgatgttggt
attggacttagatatgattatggtatattttatgcttccaagacattttatgatcagagt
aaggggagaagagtgttgtggggttggattggagaatctgatagtgaatatgctgatgtg
gccaaaggttgggcttcggttcagggtattccaagaacagtgacacttgatcagaaaact
ggtagcaacttacttcaatggcctgtagcggaggtggaaagtttgagattgagaagcgat
gagtttgaaaatttaactgtgaagccagggtcagcggtgccactagaaattggaacagct
gctcagttggacattgtagctgagtttgagatagataaggaagccttggagaagacagtt
gagtccaatatggagtacaagtgtagcaccagtggtggagcagcagaacgtggtgcatta
ggtccttttggtcttctagttttggcagatgatgacctttctgaatacactcccacatac
ttttatgttgtcaaaggaagcgatggtcatcttaaaactttcttctgctccgatcaatca
aggtcttctctagcaaatgatgttggtaagaaaatctttggaagctttgttccagtacta
aaagacgaaaagttatccgtaaggatattggtggaccattctatagttgaaagctttgct
caaggtggaaggacgtgcgtgacatctcgtgtttatccaacgagggcaatttatggagct
gctcgattgttcttgttcaataatgctactgagggcactgtgactgcttcactaaaggtt
tggcaaatgaattctgcattcatacgaccataccatcccgaccaaaggaattaa

DBGET integrated database retrieval system