KEGG   Cajanus cajan (pigeon pea): 109801757Help
Entry
109801757         CDS       T04868                                 

Definition
(RefSeq) uncharacterized protein LOC109801757 isoform X1
  KO
K15891  NAD+-dependent farnesol dehydrogenase [EC:1.1.1.354]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00900  Terpenoid backbone biosynthesis
ccaj00909  Sesquiterpenoid and triterpenoid biosynthesis
ccaj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    109801757
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    109801757
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.354  farnesol dehydrogenase (NAD+)
     109801757
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_4 NAD_binding_10 NmrA Polysacc_synt_2 RmlD_sub_bind adh_short KR
Motif
Other DBs
NCBI-GeneID: 109801757
NCBI-ProteinID: XP_020218466
Position
7
AA seq 331 aa AA seqDB search
MKVLVTGASGYLGGRLCDALLRRGHSVRALVRSTSDISALSSHIEIFYGDVTDYASLLAA
FSSCSVVFHLAALVEPWLPDPSKFFSVNVGGLKNVLAAVKETRTVEKLVYTSSFFALGPT
DEGIADENQVHHEKFFCTEYEKSKVAADKIALQAASEGVPIVLLYPGVIYGPGKVTAGNV
VARMIVERFSGRLPGYIGYGSDKFSFSHVEDVVEGHIAAIEKGEGGNRYLLTGENASFNH
VFDMAAVITNTKRPVLNIPLWLIEAYGWLLVFFARITGKLPLISPPTVHVLRHRWEYSCD
KAKRELDYRPRSLKEGLVEIHQQVVANRNLL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtattggtgaccggtgcgtccggttacctcggcggaagactctgcgacgctctg
ctccgccgaggccattccgtgagggccctcgttaggtccaccagcgatatctccgctctt
tcttcgcacatcgaaatcttctacggcgacgtcaccgactacgcctctctcctcgccgca
ttctcctcctgctccgtcgtcttccacctcgccgccctcgtcgaaccttggctccccgac
ccctccaaattcttctccgttaacgtcgggggattgaaaaacgtgttggcggcggtcaag
gagactcgcacggtggagaaactcgtctatacgtcgtcgtttttcgctctaggaccgact
gatgaaggcatagcggatgagaatcaggttcatcatgagaagtttttctgtacggagtat
gagaaatcgaaggtagctgccgataagattgcgttgcaagctgcgtcggagggtgtgccg
atagtgttgctgtatcccggagtaatctacgggcctggtaaggttactgcaggaaacgtt
gttgcgcgaatgatagtggaacggtttagtggtagattgcctggttacatagggtatggg
agtgacaagttttcgttcagccatgtggaggatgtggtggaggggcacattgcagcaata
gagaaaggagaaggtgggaataggtatctactaacgggggaaaatgcgtcgttcaatcat
gtttttgatatggctgctgtgattactaatacgaagagaccagtgcttaacatccctttg
tggctaattgaagcctatggctggctcttggttttcttcgctagaatcactggaaagcta
cctctcatcagtccaccgactgtacatgttttgagacatcggtgggagtattcgtgcgac
aaagctaaaagggagctggattataggcccagaagcctgaaagaaggtcttgtggagatc
caccaacaggttgtagcaaataggaacctgttatga

DBGET integrated database retrieval system