KEGG   Cajanus cajan (pigeon pea): 109803166Help
Entry
109803166         CDS       T04868                                 

Definition
(RefSeq) aspartate--tRNA ligase, chloroplastic/mitochondrial
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    109803166
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ccaj01007]
    109803166
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ccaj03016]
    109803166
   03029 Mitochondrial biogenesis [BR:ccaj03029]
    109803166
Enzymes [BR:ccaj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     109803166
Amino acid related enzymes [BR:ccaj01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   109803166
Transfer RNA biogenesis [BR:ccaj03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    109803166
 Prokaryotic type
   Other AARSs
    109803166
Mitochondrial biogenesis [BR:ccaj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    109803166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d
Motif
Other DBs
NCBI-GeneID: 109803166
NCBI-ProteinID: XP_020220208
Position
8
AA seq 663 aa AA seqDB search
MSLFLKALPLMAIRTRPSLAFLCRVPSAIPLTLSRTRNVFSVSASTQTSPSTSETLTSNA
KPPFALSESLEWVNRTALCGELTLNDVGKKVQLCGWVALHRVHGGLTFLNLRDHTGIVQV
TTLPDEFPDAHSAINDLRLEYVVAIEGVVRSRPNESINKKMKTGLIEVAANRVQVLNSVN
SKLPFLVTTADDAKDSLKEEIRLRYRCLDLRRQQMNFNILLRHNVVKLIRRYLEDVHGFV
EIETPILSRSTPEGARDYLVPSRIQPGTFYALPQSPQLFKQMLMVAGFDKYYQIARCFRD
EDLRADRQPEFTQLDMEMAFTPLEDMLTLNEELIRKVFLEIKGVELPNPFPRLTYAEAIS
RYGSDRPDTRFDLELKDVSDIFSGSSFKVFSDSLESGGVIKVLCVPSGTKKYSNSALKKG
DIYNEALKSGAKGLPFLKVLDDGNVEAISALVSSMDPTTRENLLRRCSAGPSDLILFAVG
HHASVNKTLDRLRVYVAHDLGLIDHGRHSILWITDFPMFEWNDPEQRLEALHHPFTAPNP
EDMNDLASARALAYDMVYNGVEIGGGSLRIYKRDIQQKVLEIVGISVEQAEAKFGYLLEA
LDMGAPPHGGIAFGLDRLVMLLAGANSIRDVIAFPKTTTAQCALTRSPSEVDPQQLKDLS
IKT
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttttccttaaagctttgcctttgatggccatccgcacgaggccatctttggcg
tttctctgcagagttcccagcgccattccactgacactttccagaacaagaaacgtgttc
tccgtttctgcttcaacacaaacatctccttctacttctgaaacactcacttctaatgcc
aaaccaccttttgccctgagtgaatcccttgagtgggtcaacaggactgcactttgtggt
gaattgactttgaatgatgtgggaaaaaaggtccagctttgtgggtgggttgcccttcac
agggtccatggtggccttacatttcttaatctcagagaccacactggcattgttcaggtt
acaacccttccggatgaatttccagatgcccattctgctatcaatgacttgaggcttgag
tacgtggttgccattgaaggtgttgtcaggtctaggccgaatgagtcaatcaacaagaag
atgaaaacaggcctcatcgaggttgctgcaaatagagttcaagtgctaaattctgtaaat
tcaaagctgccattcttagtgactacagcagatgatgcaaaagactctcttaaagaggaa
atccgattgaggtatcgatgtcttgatctgaggcggcaacaaatgaatttcaacattttg
cttcggcataatgtggttaaactcattcgaagatatctagaagatgttcatggttttgtg
gagattgaaactccaatactatcaaggtccacaccagaaggtgcccgggattatctagtt
ccatcaagaatccagccaggaacattctatgccttgccacaaagtcctcagctatttaaa
caaatgctaatggtagctggttttgataaatattatcagattgcaagatgttttcgcgat
gaagatttaagagctgataggcaacctgagttcacgcagctagatatggaaatggccttt
actcctttagaagatatgttgacactaaatgaagaattgattagaaaggttttccttgaa
attaaaggtgtggaattaccaaacccttttcccaggcttacatacgctgaagcaattagt
agatatggttcagaccgaccagataccagatttgatctcgagttgaaagatgtatctgac
attttctcagggtcttccttcaaggttttctctgattccttggagagtgggggagttatc
aaagtgttatgtgtaccttctggtaccaaaaaatactcaaattcagctcttaagaaaggt
gatatttacaacgaagcactcaaatctggtgcaaagggattgccttttctcaaggtcttg
gatgatgggaatgttgaggcaatttctgctttagtatcaagtatggatcctacaactaga
gagaatttgttaaggcgatgctctgcaggaccaagtgatctcattctatttgcagtgggt
catcatgcgtctgtaaataaaactttagaccgtcttagagtttatgtagcccatgaccta
ggtttgattgaccatggcaggcattcaattttgtggatcactgattttccaatgtttgag
tggaatgatccagagcagaggcttgaggctcttcatcatccttttactgcaccaaatcct
gaagacatgaatgaccttgcatctgctcgtgcattggcttatgacatggtttacaacggg
gtggagattggtgggggaagtttgagaatttacaaacgtgatatacaacaaaaggttttg
gagattgttggcatctcagtggagcaggctgaagcgaagtttggttatcttcttgaagcg
cttgacatgggggctccaccacatggaggcatagcttttggattggacagattagttatg
ctgttggcgggggctaattccatcagggatgtcattgcttttccaaaaacaaccactgca
cagtgtgccctcaccagatcaccatctgaggtggatccgcagcagctgaaagatctgtca
attaaaacgtag

DBGET integrated database retrieval system