KEGG   Cajanus cajan (pigeon pea): 109803358Help
Entry
109803358         CDS       T04868                                 

Definition
(RefSeq) glutathione gamma-glutamylcysteinyltransferase 1-like isoform X1
  KO
K05941  glutathione gamma-glutamylcysteinyltransferase [EC:2.3.2.15]
Organism
ccaj  Cajanus cajan (pigeon pea)
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109803358
Enzymes [BR:ccaj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.15  glutathione gamma-glutamylcysteinyltransferase
     109803358
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phytochelatin_C Phytochelatin
Motif
Other DBs
NCBI-GeneID: 109803358
NCBI-ProteinID: XP_020220483
Position
8
AA seq 494 aa AA seqDB search
MAKAGFYRRLLPSPPAVEFASSKGKQLFLEAIQNGTMQGFFKLISYYQTQSELAFCGLTT
LSMVLNALAIDPGRKWKGLLSIFILQYVGPWRWFDESMLGCWEPLETAKVKGISFRKLVC
LAHCAGAKVEAFRASSSTIEEFRKYVIECSRSEDCHVIASYHRAAIKQTGGGHFSPIGGY
HPEKDMVLILDVARFKYPPHWVPLEVLWEGMNYVVDTTRLTRGFMLISRPHRELYTLSCK
HRNWFKIVKFLLDDIPILLKSEDMKDIHQILSIIVTSLPSNFEEFIKWVVEIRRQEDGGP
SEEVLKQLQGTELFKYVNSYLSNSYNRQTTASVNGNTLPASVCCQGPKILGGKPDSSVGY
CCRETHMRSLKAEDDKPITTVSGTVVDGNSEHGVDVLISSSSGKLRYSCSNPNKNISMHP
AGTDVLTVLLLSLPSTTWDGIIDEQLLAKIRDLVPIDNLPTLLQEEVLHLRRQLHLLKRC
QEGKVDKDLGARFS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagcggggttctatcgacgccttctcccttctccccccgcagtagaattcgca
tcctcaaaaggaaagcaacttttcttggaagccattcagaatggaaccatgcaaggcttc
ttcaagttgatttcctattaccaaacacagtctgaactcgccttctgcggcctcactacc
ttgtccatggttctcaatgcccttgccattgatcctggtaggaaatggaaagggctgctg
tctatttttattctccaatatgtagggccttggagatggtttgatgaatcaatgttgggt
tgttgggaacctttagagacggccaaagttaaaggcatcagttttagaaaacttgtgtgt
ttggctcattgtgctggggcaaaagttgaagcctttcgtgcaagtagtagcactattgaa
gaatttcgtaagtatgtcattgagtgttcacgttctgaggattgtcatgtcatcgcatca
taccacagagccgctatcaaacaaaccggaggtggtcacttttctcctattggaggatat
caccctgaaaaggatatggtacttattttggatgttgcacgttttaagtatcctccccat
tgggtcccacttgaagttctctgggagggcatgaattatgttgttgacactactagacta
actagggggttcatgcttatatcaaggcctcatagggaactttatactctgagctgcaaa
cacagaaattggtttaaaattgtaaagtttctgctagacgatattccaattctattaaaa
tcagaggatatgaaagacattcatcagattctttcaataatagtcacatcacttccatct
aattttgaagaattcatcaaatgggtcgtagagatcaggagacaagaggatggtggtcca
agtgaagaggtattgaaacagttacaggggactgagcttttcaaatatgtaaattcgtat
ttgtcaaattcttacaacagacaaacaacagcttcagttaatggaaacacgttacctgca
agtgtttgttgtcaaggaccaaaaattttaggtgggaaaccagactcgtcagtaggttat
tgctgccgagaaacacatatgagaagcttaaaagctgaagatgacaagccaataacaacg
gtttctgggactgtagtagatggtaactccgagcatggggttgatgtgttgatttcttca
tcatctgggaaattacgctacagttgctctaatccaaataagaacattagcatgcaccct
gccggcactgatgttctaaccgtgcttctactgtccttaccatctacaacatgggacggc
atcatagatgagcaacttttggccaaaatacgtgatctggttccaattgataatcttcct
actttgcttcaggaagaggttttgcacttgagacgacagttacaccttctcaagagatgc
caagaaggtaaagtggataaggatcttggtgcgcgtttctcttag

DBGET integrated database retrieval system