KEGG   Cajanus cajan (pigeon pea): 109803930Help
Entry
109803930         CDS       T04868                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP40-like
  KO
K05864  peptidyl-prolyl isomerase D [EC:5.2.1.8]
Organism
ccaj  Cajanus cajan (pigeon pea)
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ccaj03110]
    109803930
Enzymes [BR:ccaj01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     109803930
Chaperones and folding catalysts [BR:ccaj03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    109803930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase TPR_1 TPR_2 TPR_8 TPR_11 TPR_7 TPR_14 TPR_6 TPR_12 MIT TPR_19 TPR_17 TPR_16
Motif
Other DBs
NCBI-GeneID: 109803930
NCBI-ProteinID: XP_020221199
Position
8
AA seq 360 aa AA seqDB search
MANPKCFLDVSIAGDLEGRIFVELFRDVVPKTAENFRALCTGEKGLSATSAVPLHFKGVR
FHRVIKGFMIQGGDITAGDGTGGESIYGPAFDDESLDLKHERKGMLSMANAGPNTNSSQF
FITTTRTPHLDGKHVVFGRVLKGMGVVRSVEHVVTGDNDRPIQDVLVVDCGEIPEGEDDG
VVNFFKDGDTYPDWPMDLDVKPDELSWWMSAVDAIKALGNEQYKKQDYKMALRKYRKALR
YLDVCWEKDDIDQEKSAALRKTKSQIFTNSSACKLKLGDLQGALLDSDFAMHDGDNAKAL
FRKGQAYMFLNDLDSAVESFKKALELEPNDGGIKKEYATARRKVADRRDQEKKAYSKMFK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacccaaagtgcttcctcgacgtctccatcgccggcgacctcgaaggcaggatc
ttcgtcgagctcttccgcgacgtcgtccccaagacagcagagaatttccgcgccctctgc
accggcgaaaagggcctctccgccacctccgccgtccccctccacttcaagggcgtccgc
ttccaccgcgtcatcaagggcttcatgatccagggcggcgacatcaccgccggcgacggc
accggcggcgagtccatctacggccccgccttcgacgacgagagcctcgacctgaagcac
gagcgcaagggcatgctctccatggccaatgcgggccccaacaccaactcctcccagttc
tttatcaccaccacgcgcacgcctcacctcgacggcaagcacgtcgtcttcgggagagtc
ctcaagggcatgggcgtcgttcgctccgtcgaacacgtcgttacgggagataacgaccgt
cctattcaagacgtcctcgttgtggattgcggcgaaattcccgaaggggaggacgatggc
gttgttaacttctttaaggatggtgacacctatcctgattggcccatggatcttgatgtc
aaacccgatgaactttcttggtggatgagtgctgtcgacgccatcaaagccctcggaaat
gaacagtataagaagcaagattataagatggctctcagaaagtatcgcaaagcgttgcgc
tatttggatgtttgttgggagaaggacgacattgaccaagagaagagtgctgctttgagg
aagacgaaatctcaaatctttaccaacagttctgcttgtaaattgaaattaggcgatcta
caaggagccttactggattcagactttgcaatgcatgatggagataatgcaaaagctctg
tttcgcaaaggccaggcatatatgtttctcaacgacctagattctgctgttgaaagcttc
aagaaagcattggagttggagccgaatgatggagggattaaaaaagagtatgccactgcc
aggaggaaggttgctgatagacgtgatcaagagaaaaaagcttattctaaaatgttcaaa
tag

DBGET integrated database retrieval system