KEGG   Cajanus cajan (pigeon pea): 109804590Help
Entry
109804590         CDS       T04868                                 

Definition
(RefSeq) tyrosine decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00350  Tyrosine metabolism
ccaj00360  Phenylalanine metabolism
ccaj00380  Tryptophan metabolism
ccaj00950  Isoquinoline alkaloid biosynthesis
ccaj00965  Betalain biosynthesis
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    109804590
   00360 Phenylalanine metabolism
    109804590
   00380 Tryptophan metabolism
    109804590
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    109804590
   00950 Isoquinoline alkaloid biosynthesis
    109804590
   00965 Betalain biosynthesis
    109804590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109804590
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     109804590
    4.1.1.105  L-tryptophan decarboxylase
     109804590
Exosome [BR:ccaj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109804590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 109804590
NCBI-ProteinID: XP_020222034
Position
8
AA seq 488 aa AA seqDB search
MEESRLMPMDAEQLRDHAHKMVDFIADYYKTIQTFPVLSQVQPGYLGKLLPDSAPNYPDS
LQNVLNDVQEKILPGVTHWQSPNYFAYFPSNSSIAGFLGEMLSAGLNIVGFSWITSPAAT
ELETIVLDWLAKALQLPDDFYSSGQGGGVIQGTASEAVLVVLVAARDKILRRVGRSALPK
LVMYASDQTHSALQKACQIAGLNPELCRLLKTDSSTNYALSPDVLSEAISSDIAGGLVPF
FLCATVGTTSSTAIDPLPALGKIAKTNKLWFHVDAAYAGSACVCPEYRHCIDGVEEADSF
NMNAHKWFLTNFDCSVLWVKDRSSLIQSLSTNPEFLKNKASQGNMVIDYKDWQIPLGRRF
RSLKLWMVLRLYGLEGLRSHIRNHIEMAAYFEELVGQDTRFKVIAPRTFSLVCFRLLPLL
NSEDHGNKLNSDLLDSVNSTGNAFITHTVLSGEYVLRFAVGAPLTERKHVDMAWQILQDK
ATALLESS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaagtaggttgatgcccatggacgctgagcaactgcgtgaccacgctcataag
atggtcgacttcatcgctgattactacaaaaccatccaaactttccccgttctcagccaa
gtccagccaggttatcttgggaagcttttaccagattctgcaccaaattatcctgattca
ttgcaaaatgttttgaatgatgtacaggaaaaaatactcccaggggtcacacattggcaa
agccccaattattttgcttattttccttccaatagtagcattgctggatttctaggagag
atgctcagcgcgggtcttaacattgtgggtttcagttggataacttctcctgccgcaact
gaacttgaaaccattgtgctggactggcttgcaaaggcgctccagctgcctgatgatttc
tattctagtgggcaaggtggtggagttatacaggggacagcaagtgaagctgtacttgtt
gtcttagtagctgcccgtgacaagatcttaaggagggttggaaggagtgcccttccaaag
cttgtgatgtatgcatctgatcaaacacattctgctttacaaaaagcttgtcagatagca
ggacttaatccagagctttgcaggttgcttaaaactgattcttccacaaattatgcactt
tctcctgatgtactttctgaagcaatttcaagtgatattgctggcggtcttgtacccttt
ttcttatgtgctactgttggtaccacttcatcaacagctattgatcctttgcctgcattg
ggaaaaattgccaagaccaacaaactttggtttcacgtggatgctgcttatgctggaagt
gcttgtgtttgtccagagtaccgccattgcattgatggtgttgaagaagcggactcattt
aacatgaatgcacataaatggttcctgactaattttgactgttcagtactttgggttaag
gacagaagttctctgattcaatcactgtctacaaatcctgaatttctgaaaaacaaggcc
tctcaaggaaacatggttatagattacaaagattggcaaatacctcttggacgtcgcttt
agatcattaaaactgtggatggtgttgcgactttatggattggaaggtctgcgaagtcac
ataagaaaccacattgagatggctgcttattttgaggagcttgttggtcaggacacaaga
ttcaaggtcattgcaccccggacattctccttagtttgctttcggctgttgccccttcta
aattctgaagatcatggcaataaactcaattctgatctactcgactcagtaaattcaaca
ggaaatgccttcataacacacacggttttatcaggtgagtacgttcttcgtttcgcagta
ggagcaccattgacagaaaggaagcatgtagatatggcgtggcagattttgcaagacaaa
gccactgcactacttgagagttcatag

DBGET integrated database retrieval system