KEGG   Cajanus cajan (pigeon pea): 109805702Help
Entry
109805702         CDS       T04868                                 

Definition
(RefSeq) 5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase 1-like isoform X1
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00270  Cysteine and methionine metabolism
ccaj00450  Selenocompound metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    109805702
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    109805702
Enzymes [BR:ccaj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     109805702
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Meth_synt_2 Meth_synt_1
Motif
Other DBs
NCBI-GeneID: 109805702
NCBI-ProteinID: XP_020223465
Position
10
AA seq 802 aa AA seqDB search
MFKVSIQCVAPFTFSLSSLSFSSSSLSFSVRSTSIRAMASHIVGYPRMGPKRELKFALES
FWDGKSSAEELQKVAADLRSAIWKQMAEAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYD
WNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYIVPELGPDVKFSYASHKAVDEYRE
AKVLGINTVPVLVGPVSYLLLSKPSKGVEKSFSLLSLIDKILPVYREVVAELKAAGATWI
QFDEPTLVKDLDANQLQAFTHAYAELESSLSGLNVLIETYFADVPAEAYKTLTSLKAVTA
YGFDIVRGTKTLDLIKQGFPSGKFLFAGVVDGRNIWANNLASSLNTMQALGDIVGKDKVV
VSTSCSLLHTAVDLVNETKLDQEIKSWLAFAAQKVVEVNALAKALSGQKNEVFFSANAAA
LASRKSSPRVTDEAVQKAAAALRGSDHRRAANVSARLDAQQKKLNLPVLPTTTIGSFPQT
SDLRRVRREFKANKISEEDYIRFIKEEINNVVKLQEELDIDVLVHGEPERNDMVEYFGEQ
LSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSSTAQSMTRRPMKGMLTGPVT
ILNWSFVRDDQPRFETCYQIALAIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEEAFY
LNWAVHSFRITNCGVKDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVF
REGVKYGAGIGPGVYDIHSPRIPPTGEIADRINKMLAVLESNILWVNPDCGLKTRKYTEV
KPALTNMVAAAKLIRNLLASAK
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaagtctccattcagtgtgtggcgccgtttacattctctctctcctctctctcc
ttctcatcctcttctcttagtttctctgttcgttctacttctattcgagcaatggcatct
catattgttggttatccacgcatgggacccaagagagagcttaagtttgccttggaatcc
ttttgggatggaaagagtagtgctgaggagctgcagaaggttgctgcagaccttaggtca
gccatctggaagcagatggctgaagctggaataaagtatattccaagcaacaccttctca
tactatgatcaagtactggacacaacagccatgcttggggcagttcctcctagatatgat
tggaacggtggggagataggatttgatgtttacttctccatggcaagagggaatgcatct
gtaccagctatggaaatgaccaagtggtttgacaccaactaccactacattgttcctgaa
ttgggtccagatgttaagttctcctatgcatcacacaaggctgtggatgaatacagagag
gccaaagttctgggaattaatactgtacctgtgcttgtgggacctgtatcctacttgttg
ctgtcaaagccatctaagggtgttgagaagtcattttcccttctttccttaattgacaag
atccttcctgtctacagggaggttgtggctgaactgaaggcagctggtgctacctggatt
cagtttgacgaacctacccttgtgaaggatctcgatgctaaccagttacaagcatttaca
catgcctatgcagagctagaatcaagtttatctggtttgaatgttctgattgagacatac
tttgctgatgtccctgctgaagcatacaaaacactcacctctttgaaggctgttactgca
tatggatttgacattgttcgtggaacaaagacccttgatttgatcaagcaaggatttcca
tctggaaaatttctttttgctggtgttgttgatggaagaaatatttgggccaataatctt
gcgtcttctctgaacaccatgcaggcgcttggggacattgttggcaaagacaaggttgtg
gtttccacatcctgttctcttcttcacactgcagttgatctggtgaatgagaccaagttg
gaccaagagattaagtcttggctcgcatttgcagcacaaaaagttgttgaagtaaatgcc
ttggccaaggcattgtctggacagaagaatgaggttttcttttctgctaatgctgctgcc
ttggcttcaaggaagtcctccccaagagtgacagatgaggctgttcaaaaggctgctgct
gctctgaggggctctgatcatcgaagggccgcaaatgttagtgccaggttggatgctcaa
caaaagaaactgaatcttcctgttcttccaaccactacaattggatcttttcctcagact
tctgatcttagaagagttcgccgtgagttcaaggcaaacaagatctctgaggaagattat
atccgtttcattaaggaggaaattaacaatgttgtgaagctccaggaagaactagacatt
gatgtcttggtgcatggagagcctgagaggaatgacatggttgagtattttggagaacaa
ttgtctggctttgctttcactgccaatgggtgggtgcaatcatatggatcccgctgtgtc
aaaccacccatcatatacggtgatgtgagccgtcccaagcccatgactgttttctggtct
tcaactgctcaaagtatgaccagaagaccaatgaagggaatgcttactggccctgttact
attctgaactggtccttcgttagagatgaccagccaagatttgaaacatgctaccagatt
gctttggctatcaaggatgaggttgaggatcttgagaaagctggtattactgtcatacag
attgacgaggctgctctaagagaaggtttgcctctgaggaagtctgaggaggctttctat
ctgaactgggcagttcactcatttagaattaccaactgtggtgtgaaggatactactcag
attcacactcatatgtgctactccaacttcaatgatatcattcactcaatcatagacatg
gatgctgatgtgatcactattgagaactctagatcagatgagaagttactttcagtcttc
cgtgagggagtgaaatatggagctggcattggtcctggtgtttatgatattcactcaccc
aggattccacctacaggagaaattgctgacaggatcaacaagatgcttgcagttcttgaa
agcaacattctctgggtcaacccagactgtggcctcaagacacgcaaatacactgaggtc
aaacctgctctcaccaatatggttgctgctgccaaacttattcgcaacctgttagctagt
gccaagtga

DBGET integrated database retrieval system