KEGG   Cajanus cajan (pigeon pea): 109806164Help
Entry
109806164         CDS       T04868                                 

Definition
(RefSeq) nicotianamine synthase-like
  KO
K05953  nicotianamine synthase [EC:2.5.1.43]
Organism
ccaj  Cajanus cajan (pigeon pea)
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109806164
Enzymes [BR:ccaj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.43  nicotianamine synthase
     109806164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAS Methyltransf_31 Methyltransf_25 Methyltransf_24 CheR Methyltransf_23 SWIB Methyltransf_11
Motif
Other DBs
NCBI-GeneID: 109806164
NCBI-ProteinID: XP_020224133
Position
10
AA seq 273 aa AA seqDB search
MASNDHLIAQIMQLHASISKLESLKPCKQVNSLFTHLVKLCTLPSSIDIESLPQEVQHMR
ESLINLCGDAETLLELEFSSFLILTPEPMKNVTLFPYYGNYIKLAHLENKILKENGVVNP
KKVAFVGSGPMPLTSIIMATHHMHSTHFDNFDVDHKANEVARKIVASDVALEKRMKFVTQ
DIVDVRERLGQYDCIFLAALVGMRKEEKVKILGHMWKYMKEGGFLLVRSAKGARAFLYPV
IEERDMVNFEVLAMFHPTDDIINSVVLLRKPKA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggcttctaacgatcacctcatagctcagatcatgcaacttcatgcaagcatctccaag
cttgaatctctcaaaccttgcaagcaagtcaatagtctcttcacacacctagtgaaacta
tgcaccctcccttcatccattgacatcgagtccttgccccaagaggtgcaacacatgcgt
gagagcctcatcaacctttgtggcgacgctgaaaccctcttggagctcgaattctcatct
ttcctaatcctcacacccgagccaatgaagaacgtgaccctcttcccctactatggaaac
tacatcaaactagcacacttggagaacaaaatcctcaaggaaaacggggtggtgaaccca
aagaaagtggcgtttgtagggtcaggtccaatgccactaacttccatcataatggccaca
caccacatgcattccacgcactttgacaacttcgatgttgatcacaaggccaatgaggtg
gcacgcaagatcgtggcttctgatgtggcacttgagaagaggatgaagtttgtgacgcaa
gacatcgtggacgtgagagagaggctagggcaatatgattgcatctttttggcagcactt
gtgggaatgagaaaagaagaaaaagtgaagattctagggcacatgtggaagtacatgaag
gaaggagggtttttgcttgtgagaagtgcaaaaggggctagggctttcttgtaccctgtg
attgaggaacgtgacatggtgaattttgaggttcttgccatgtttcaccccacagatgat
atcatcaactcggttgttcttcttcgcaagcctaaagcttaa

DBGET integrated database retrieval system