KEGG   Cajanus cajan (pigeon pea): 109807398Help
Entry
109807398         CDS       T04868                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 2-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00520  Amino sugar and nucleotide sugar metabolism
ccaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    109807398
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     109807398
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 adh_short KR
Motif
Other DBs
NCBI-GeneID: 109807398
NCBI-ProteinID: XP_020225505
Position
11
AA seq 418 aa AA seqDB search
MTSELIHRTTQTPEPPNRSSGSATPMNPIRQRLPFLLVGVAIASVFFHLLPSGSLVAAPH
ESFLETELALPTRRVLLEGASSEKKGRVPLGVKSRKQKRILVTGGAGFVGSHLVDRLMER
GDSVIVVDNFFTGRKENVLHHMGNPNFELIRHDVVEPILLEVDQIYHLACPASPVHYKFN
PVKTIKTNVVGTLNMLGLAKRIGARFLLTSTSEVYGDPLQHPQAETYWGNVNPIGVRSCY
DEGKRTAETLAMDYHRGAGIEVRIARIFNTYGPRMCIDDGRVVSNFVAQALRKEPLTVYG
DGKQTRSFQYVSDLVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQVVQETIDPNAKIEFR
PNTEDDPHKRKPDISKAKELLGWQPSVSLREGLPLMVTDFRQRLFGESKLTGGKAVSA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgacctcagagctcattcacagaacaacgcagacaccagaaccccccaatcgcagttcc
ggttcagccacgccgatgaacccaatccgacagcgcctgccgttcctgctggtgggggtg
gccatcgccagcgtgttcttccacctcctcccttctgggtccctagtggccgccccccac
gagtccttcctggaaacggagttggctctgccgactcggcgcgtgctgttggaaggagcg
tcgtcggagaagaagggaagggttcctctgggagtgaagagcagaaagcagaagaggatc
ctggtgacgggtggagcgggtttcgttggaagccatctggtggaccgtttgatggaaaga
ggcgatagcgtgatcgtggtggataacttcttcacgggaaggaaagagaacgtgctgcac
cacatggggaaccccaacttcgaactcattcgacacgacgtcgttgaacccatccttctc
gaggttgaccagatctaccacttggcctgccccgcttcccctgtccattacaagttcaac
cccgtcaagaccatcaagaccaatgtcgttggcacgctcaacatgctcggattggctaag
agaataggtgcacgttttttgttgacaagcaccagtgaggtctacggtgatccccttcag
caccctcaggctgagacctactggggcaacgttaaccccatcggcgtcaggagttgttat
gacgagggcaagcgtactgcagagactttggctatggactatcacagaggcgcgggtatt
gaggtgaggattgctcgaatcttcaacacttacgggcccagaatgtgcattgatgatgga
cgtgtagtcagtaacttcgttgctcaggcgttgaggaaggagccattgactgtttatggc
gatggaaaacagacaagaagctttcaatatgtctcagacctggttgaaggcttaatgcgg
ttgatggaaggtgagcatgttggtcctttcaatcttggcaaccctggtgaattcaccatg
cttgaattggctcaggtggtacaagagactatagacccaaatgcgaagatagagtttaga
ccaaacacagaagatgatccacataagaggaagccagacatctccaaagcgaaggagctt
cttggatggcaaccctctgtgtccctccgtgagggacttcctctaatggtcactgatttc
cggcaaagattgtttggtgagtcaaaactcactgggggcaaagctgtatctgcatag

DBGET integrated database retrieval system