KEGG   Cajanus cajan (pigeon pea): 109807495Help
Entry
109807495         CDS       T04868                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00970  Aminoacyl-tRNA biosynthesis
ccaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    109807495
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ccaj03029]
    109807495
Enzymes [BR:ccaj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     109807495
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     109807495
Mitochondrial biogenesis [BR:ccaj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    109807495
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln RasGEF
Motif
Other DBs
NCBI-GeneID: 109807495
NCBI-ProteinID: XP_020225619
Position
2
AA seq 144 aa AA seqDB search
MSSKGLLRGASVSANAVWHRSSFFPKVTVSVHRKLFKFRSFSSTATTCSSLQPPDLPRLA
KTAQISLTPNEVEEIAPKIQQVIDWLGQLQSVDLESVEPSIRAETENNLRENAPETFDHR
DGMIASVPSYEEPYIKVPRVLSMD
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtaaggggttactgagaggagcttcggtgagtgcgaatgcagtgtggcacaga
agcagtttcttcccgaaggtaacggttagcgtccaccgcaagttgttcaagtttcgaagc
ttttcgtcaaccgccactacttgctcctctcttcaacccccggatttgcctcgtttggcc
aaaacagctcaaatttcccttaccccaaacgaggttgaagaaattgctcccaaaattcaa
caagttatagactggcttggacagctgcagagtgttgatcttgaaagcgttgaaccctcc
atcagagcagagactgaaaacaatctgcgtgagaatgctcctgaaacatttgatcatagg
gacggcatgatcgcttctgtcccgagctacgaggagccttatattaaagttccaagggtc
ttaagcatggattag

DBGET integrated database retrieval system