KEGG   Cajanus cajan (pigeon pea): 109809735Help
Entry
109809735         CDS       T04868                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00010  Glycolysis / Gluconeogenesis
ccaj00562  Inositol phosphate metabolism
ccaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109809735
   00562 Inositol phosphate metabolism
    109809735
Enzymes [BR:ccaj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     109809735
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     109809735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 109809735
NCBI-ProteinID: XP_020228709
Position
11
AA seq 493 aa AA seqDB search
MKYSISFLLLIFLWALHYSNAEEPFDVRKHLSTVSRYGVVKDIADNNFVPSNIPEGCIPI
HLNLVARHGTRSPTKKRIKELDTLSARLEVLVRDAKERNLPLERVPSWLNGWKSPWQGRR
KGGELIIKGEEELYDLGIRIREKFPNLFDEEYHPDVYPIKASQVPRASASAVAFGMGLFS
GNGSLGPGYHRAFSVTSESRASDIQLRFHDCCHNYKDFRKRQEPTVSKLKEPILDEITSA
LIGRHGLNFTRQDTSSLWFLCKQEASLLDITNQACSIFSPTEIELLEWTDDLEMFILKGY
GNSLNYRMGLPLLEDVLLSMEQVINAKEERHAPGSLEKARLRFAHAETIVPFSCLLGLFL
EGSEFKQIQKEQHLPLPPKPPQKRKWRGNTVAPFAGNNMLVLYSCPAPDKSMSKHFVQVL
HNEHPVPMQGCGGSDFCPFEVFKEKIVAPHQKHDYHTVCNVKLEQKPSGSRIFQIFQWLS
SRGKGDKYPKDEF
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaagtactctatttccttccttcttctaatattcctttgggcattacactactcaaac
gccgaagaacctttcgatgttcgcaaacacctctccactgtctcaagatatggtgttgtg
aaagacattgctgacaataactttgttccttctaatatccccgagggatgtattccgatc
catttgaaccttgtggcaaggcatggaactcgatctcctacaaagaaaaggataaaggag
ttagatactttgtcagctcgtttggaagttcttgtaagggatgcaaaggaacgaaatttg
cctttggagagagttccctcctggctaaatggatggaaatctccttggcagggaaggcgg
aagggtggtgaactaattatcaaaggagaggaagagttatatgatcttggaatcaggatt
agagaaaagtttccaaatttgtttgatgaggaataccatccagacgtatatcctatcaag
gcatctcaggttccccgagcatctgctagtgctgtggcattcggaatggggcttttcagt
ggaaatggaagtcttggacctgggtatcaccgagccttttctgtcacaagtgaaagccgt
gctagtgacatccagctgagatttcatgactgttgtcataattacaaggattttcggaaa
aggcaggaacctacagttagtaaacttaaggaacctattttggatgagattacatctgca
ttgattgggcgccatgggctgaattttacgaggcaggatacatcttctctctggtttttg
tgtaaacaggaagcatccttgttggatataactaatcaagcgtgtagtattttcagccct
accgagattgaattgctggagtggacagatgatttggagatgtttattctgaagggttat
ggtaattcactaaattatagaatgggattgccgttactagaagatgttcttctatccatg
gaacaggttatcaacgctaaagaagaaagacatgcgcctggcagtttggaaaaggcaagg
cttaggtttgcccatgctgaaactatagttccattctcatgtctgcttggtttatttctc
gaaggatctgagtttaaacaaattcagaaggagcagcatttgccgctccccccaaagcct
ccacagaaaagaaaatggaggggtaacactgtggccccttttgctggtaacaacatgctg
gtcttgtatagttgtcctgctccagacaaatctatgagcaaacactttgtgcaagtgtta
cacaatgaacaccctgtaccaatgcagggttgtggtggctctgatttctgtccatttgaa
gtattcaaggaaaaaatagttgcacctcatcagaagcatgactatcatacggtctgtaat
gtaaagctagagcagaagccttctggcagcaggatttttcaaatatttcagtggctttcc
tcacgagggaaaggtgataagtaccctaaagatgaattttag

DBGET integrated database retrieval system