KEGG   Cajanus cajan (pigeon pea): 109811028
Entry
109811028         CDS       T04868                                 

Definition
(RefSeq) BAHD acyltransferase At3g29680-like
  KO
K13264  isoflavone 7-O-glucoside-6''-O-malonyltransferase [EC:2.3.1.115]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00943  Isoflavonoid biosynthesis
ccaj00944  Flavone and flavonol biosynthesis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00944 Flavone and flavonol biosynthesis
    109811028
   00943 Isoflavonoid biosynthesis
    109811028
Enzymes [BR:ccaj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.115  isoflavone-7-O-beta-glucoside 6''-O-malonyltransferase
     109811028
SSDB
Motif
Pfam: Transferase Condensation
Other DBs
NCBI-GeneID: 109811028
NCBI-ProteinID: XP_020230249
Position
Unknown
AA seq 452 aa
MAEQSPTLKLHQVHHVSPPPETPPTSLPFTFFDVLWLRFPPVERLFFYPLSNTSFFDTVL
PNLKASLSLTLHHFPTLAGTITWPQSSPLPLITYVPGNTVPLTVTQSHACFNTLSSNLCE
ASQRQRFVPHLTSSHEQASVLALQVTLFPNQGFCLGITTHHAVLDGKSSTLFLKAWAHLC
SHSHLQNPPSLPKHLTPSFDRSMIRDPSGIGEAYANSWLNFGGEANNRSLKAWGSLDGVQ
NDVVKGFFELGPSHIQKLKKLAESKVVGKKVKVTSFSVTCGYVLACAVKVDTPKRDKAAF
VITVDCRGRLDAVISETYFGNCVVPKMVVVEKSELLGEDGFVKGVEGISEVLRGLEESGA
LHDAENWMKKIQGVLGDRLFSVAGSPRFEVYGIDFGFGRPKKVDVTSIDKTGAFSLSECR
DQGGIEIGLALTKDQMEEFSRLFNQGLESLLE
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggcagaacaatcaccaaccctgaaactccaccaagtccaccacgtatctccgccgcca
gaaacccctccaacctccctccccttcaccttcttcgacgtcctttggctaaggttcccc
cccgtcgagcgtctcttcttctaccctctctccaacacttcattcttcgacacagttctc
ccnaacctcaaagcctctctttccctcactctccaccacttccccactctcgccggcacc
atcacatggccacaaagctcacccttacccctcatcacctacgtccccggcaacaccgtc
cccctcacagtaacccaatcccacgcatgcttcaacaccctctcttccaacctctgtgaa
gcatcccaacgacaacgtttcgtaccccacttaacctcttcccacgagcaagcctcggtc
ttagcccttcaagtcaccctcttcccaaaccaaggcttttgcctcggcataaccacacac
cacgcagtcctcgacggaaaatcctccaccttgttcttgaaagcatgggcacacctttgt
tctcattctcaccttcaaaaccctccttcactaccgaaacatctcacaccctcgtttgac
aggtctatgatccgtgacccttcggggatcggtgaggcctacgccaactcgtggttgaac
ttcggcggagaagccaacaaccgaagcttgaaagcgtgggggtcgctggacggggtgcaa
aacgacgtcgtgaaagggtttttcgagttggggccctcgcatatccaaaagctgaagaag
ttagcggagtctaaggttgtcggaaagaaggttaaggtaacatcgttttccgtcacgtgt
ggttatgttttggcgtgcgcggttaaggtggacacgccgaagagagacaaagcggcgttt
gtgatcacggtggattgtagggggcgtttggatgcggttatatcggaaacgtatttcggg
aactgtgtggtgccgaagatggtggtggtggagaagagtgagttattgggggaggatggg
tttgtgaagggcgttgaagggataagtgaggttttgcgagggttggaggagagtggggcg
ttgcatgatgctgaaaattggatgaagaagattcagggtgtgcttggtgataggttgttt
tcggttgcggggtctccgaggtttgaggtttatgggattgattttgggtttgggaggcct
aagaaggtggatgttacttcgatcgataaaacgggggcgttttcgctttcggagtgtaga
gatcaaggagggattgagattgggttggcgttgaccaaggatcaaatggaggagttttct
cgtcttttcaatcaaggacttgagtccttgctggaatga

DBGET integrated database retrieval system