KEGG   Cajanus cajan (pigeon pea): 109811599Help
Entry
109811599         CDS       T04868                                 

Definition
(RefSeq) arogenate dehydratase/prephenate dehydratase 6, chloroplastic-like
  KO
K05359  arogenate/prephenate dehydratase [EC:4.2.1.91 4.2.1.51]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    109811599
Enzymes [BR:ccaj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     109811599
    4.2.1.91  arogenate dehydratase
     109811599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDT ACT
Motif
Other DBs
NCBI-GeneID: 109811599
NCBI-ProteinID: XP_020230972
Position
Unknown
AA seq 428 aa AA seqDB search
MQTLSPHTSNALNLKLALRPRHSLAPTRLSVKCLFAFEPPSHGVGSTRADWQSSCAILAS
KVVSQEKSSTDQNGGTADHVAAVNGHKAAVSDLNLVPIGNLEADSNISKPQPPKPLTISD
LSPAPMHGSKLRVAYQGVPGAYSEAAAGKAYPNCEAIPCDQFEVAFSAVELWIADRAVLP
VENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHCLLALPGVRKDFLTRVISHPQALAQCE
HTLTKLGLNVAREAVDDTAGAAEFVAANNLRDTAAIASGRAAELYGLQVMADGIQDDPSN
VTRFVMLAREPIIPRTDRPFKTSIVFAHDKGTSVLFKVLSAFAFRNISLTKIESRPHRNR
PIRLVDDANVGTAKHFEYLFYVDFEASMAEVRAQNALAEVQEFTSFLRVLGSYPMDMTPW
TPSSSRAD
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccctttcgccccacacttccaacgcgctcaatctcaagctagccctccgcccg
cgccactccctcgcgccaacccgactctcagtcaaatgccttttcgcgttcgagccgcca
agccacggagtcggctctacccgagccgactggcaaagctcctgcgccatcttagccagc
aaggtcgtttctcaggaaaaatcctccactgaccaaaacggcggcacagccgaccacgtc
gccgccgtcaacggccacaaggccgccgtcagcgacctaaatctcgttcccatcggaaac
ctcgaagccgacagcaacatcagcaagccgcagccgccgaagccgctaacaatctccgac
ctctcgccggcgcctatgcacggctcgaagctgcgcgtcgcgtaccaaggcgtccccggc
gcgtactccgaggccgccgccgggaaagcctatccgaactgcgaggccatcccgtgcgac
cagttcgaggtggcgttcagcgcggtggagctctggatcgccgacagagcggtcctcccg
gtggaaaactccctcggcggctcgatccaccgcaactacgacctcctcctccgccaccgc
ctccacatcgtcggcgaggtccagctcccggtccaccactgcctcctggcgctccccggc
gtgaggaaggacttcctcacgcgcgtgatttcgcatcctcaagcgctggcgcagtgcgag
cacacgctcaccaaactcggcctgaacgtggcgcgcgaggccgtggacgacaccgccggc
gcggcggagttcgtggccgcgaacaacctccgcgacacggcggcgatcgcgagcgggcgc
gcggcggagctgtacggcctgcaggtgatggcggacggaatccaggacgatccgagcaac
gtgacgcggttcgtgatgcttgcaagagagcctatcattccgcgcaccgatcggcctttc
aagacgagcattgttttcgcgcacgacaaggggacttcggtgctcttcaaggtgctttcc
gcgttcgcctttcgcaacatcagcttgacgaagatcgagtcgcggccccaccgcaaccgt
ccgattcggctggtggacgatgcgaacgttggcaccgccaagcacttcgagtacttgttc
tacgttgatttcgaggcttccatggccgaggttagggctcagaacgctttggctgaggtt
caggaattcacctctttcttgcgagtcttgggcagttaccctatggacatgaccccctgg
actccctcctcctcccgtgctgattaa

DBGET integrated database retrieval system