KEGG   Cajanus cajan (pigeon pea): 109811723Help
Entry
109811723         CDS       T04868                                 

Definition
(RefSeq) chlorophyll(ide) b reductase NOL, chloroplastic
  KO
K13606  chlorophyll(ide) b reductase [EC:1.1.1.294]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00860  Porphyrin and chlorophyll metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    109811723
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.294  chlorophyll(ide) b reductase
     109811723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Polysacc_synt_2 Epimerase F420_oxidored GDP_Man_Dehyd NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 109811723
NCBI-ProteinID: XP_020231128
Position
Unknown
AA seq 340 aa AA seqDB search
MATTATATATPTLSFHFPSPTLSSPSSPSLFKPYTVASRQNLSFATTSFAFTNSTSPTFL
AKASPNSLPPYNVLITGSTKGIGYALAKEFLKAGDNVVVCSRSVERVETAVQSLKVEFGE
QHVWGTACDVRNAEDVKNLVSFAREKLKYIDIWINNAGSNAYSYKPLVEASDEDLVEVVT
TNTLGLMICCREAIKMMVSQPRGGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQ
AELQMQDVKNVVVHNLSPGMVTTDLLMSGVNTKQAKFFINVLAEPAEVVAEYLVPNIRSI
PANGSMKPTYIKFLTGLKAYSQIFSRLAFGARRNRYILED
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggctaccactgccactgccactgccactcccactctctccttccactttccctcccca
accctctcttcgccctcttcaccttccctattcaaaccctacaccgttgcttcccgccaa
aacctctccttcgccaccacctccttcgctttcaccaactccacctctcctacttttctc
gccaaggcttctcccaactcgctccctccttacaacgttttgatcactggctctaccaaa
ggaatagggtatgctttggcgaaagagtttctaaaagctggtgacaatgttgtggtttgc
tcgagatcagttgaaagggtagagacagctgtccagagcttgaaagtagaatttggggag
cagcatgtgtggggaactgcatgtgatgtgagaaatgcagaggatgtgaagaatttagtt
tcatttgctcgagaaaagttgaaatacattgatatatggatcaacaacgctggatcaaat
gcatatagctataagccacttgttgaggcttcagatgaagatcttgttgaggttgttaca
acaaatacacttggcttgatgatatgttgtcgagaggcaattaagatgatggtgagccag
cctcgtggaggtcatattttcaatattgatggagcaggttcagatggaagaccaactccc
aggtttgctgcatatggagcaacaaagagaagtgtggtgcatttaacaaagtcattacag
gcagaattgcagatgcaagatgttaaaaatgtggtggtgcataatctttcgccaggaatg
gttacaacggatcttctcatgtctggtgttaatacaaagcaggcaaagtttttcatcaat
gtcttggctgaaccagccgaagtggttgcagaatacttggttccaaatataagatccatc
cctgctaatggatcaatgaagccaacatacattaaatttctcactggtttgaaagcctat
tcgcagatattttcaagattggcattcggcgcaagaaggaaccgatacattcttgaagat
taa

DBGET integrated database retrieval system