KEGG   Cajanus cajan (pigeon pea): 109812402Help
Entry
109812402         CDS       T04868                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj03040  Spliceosome
ccaj04141  Protein processing in endoplasmic reticulum
ccaj04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109812402
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109812402
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109812402
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccaj01009]
    109812402
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ccaj03041]
    109812402
   03009 Ribosome biogenesis [BR:ccaj03009]
    109812402
   03110 Chaperones and folding catalysts [BR:ccaj03110]
    109812402
   04131 Membrane trafficking [BR:ccaj04131]
    109812402
   03051 Proteasome [BR:ccaj03051]
    109812402
   03029 Mitochondrial biogenesis [BR:ccaj03029]
    109812402
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccaj04147]
    109812402
Protein phosphatases and associated proteins [BR:ccaj01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     109812402
Spliceosome [BR:ccaj03041]
 Complex B
  Other components
   Prp19 complex
    109812402
 Complex C
   Prp19-CDC5 complex
    109812402
Ribosome biogenesis [BR:ccaj03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    109812402
Chaperones and folding catalysts [BR:ccaj03110]
 Heat shock proteins
  HSP70 / DNAK
   109812402
Membrane trafficking [BR:ccaj04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    109812402
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    109812402
Proteasome [BR:ccaj03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    109812402
Mitochondrial biogenesis [BR:ccaj03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    109812402
Exosome [BR:ccaj04147]
 Exosomal proteins
  Proteins found in most exosomes
   109812402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 FGGY_C Mago_nashi
Motif
Other DBs
NCBI-GeneID: 109812402
NCBI-ProteinID: XP_020231939
Position
Unknown
AA seq 303 aa AA seqDB search
MELFEECMETIERCLSDAKMEKSCVHDVVLVGGSSRIPKVQQLLQDFFNGKDLCKSINPD
EAVAYGAAVQAALLSKDIKNVPDLVLLDVTPLSLGVFVQGDLMSVVIPRNTTIPVKKTQE
YCTADDNQSSVAIKVYEGERTRASDNNLLGFFTLSNLPPAPRGLPLFECFTIDENGILSV
SAEEKTTGNKNKITITSDKDRLSTKEIERMIQEAEIYKAEDNKFLKKAKTRNDLDYYVYK
IRNVLKKEDINSMLCSQEKEDISSAINKATDLLDENYEQDDISMFEDCLKELESFFGSLK
AMG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggaactctttgaagagtgtatggagacaatagaaaggtgtcttagtgatgctaagatg
gagaagagctgtgtacatgatgtggtccttgttggtggctcttctaggattcccaaagtg
cagcagttattgcaggactttttcaatggaaaggatctttgcaagagcatcaaccctgac
gaggctgttgcttatggcgcagctgtgcaagctgctttgttgagtaaagacattaagaat
gttccagatttggtgctgttggatgttacaccgttgtcacttggtgtgtttgtccaagga
gatttaatgagtgtggtgattcctagaaatactaccattcctgtaaagaagacacaagaa
tattgtacagctgatgataaccaatcatctgttgctattaaggtttacgagggcgagaga
acaagagccagtgataacaatttgttgggtttctttactctttctaatcttccacctgct
cctcgtggccttcctttgtttgaatgctttactatagatgaaaatggcatattgtctgtt
tctgctgaggagaaaaccactggtaataagaataaaattaccataaccagtgataaagac
agattgtcaaccaaagaaattgaaagaatgatacaagaggcagagatttataaggccgaa
gataacaagtttcttaagaaggccaaaacaaggaatgatttggattattatgtttacaaa
ataaggaatgtcttaaagaaggaggatataaactcaatgctttgctcacaagaaaaagag
gatatcagttctgctataaataaggctactgatttgcttgatgagaactatgagcaagat
gatatatctatgttcgaggattgtttgaaagagcttgagagcttctttggaagcctcaag
gccatgggctag

DBGET integrated database retrieval system