KEGG   Cajanus cajan (pigeon pea): 109812807Help
Entry
109812807         CDS       T04868                                 

Definition
(RefSeq) apyrase 2-like
  KO
K14641  apyrase [EC:3.6.1.5]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00230  Purine metabolism
ccaj00240  Pyrimidine metabolism
ccaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109812807
   00240 Pyrimidine metabolism
    109812807
Enzymes [BR:ccaj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     109812807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39 Ppx-GppA
Motif
Other DBs
NCBI-GeneID: 109812807
NCBI-ProteinID: XP_020232452
Position
Unknown
AA seq 474 aa AA seqDB search
MLKRSGRPPPPPAESLFDRIYQLRGAFLMVAVPLLLVTMVLYFTPSASSNESIEDYALTH
RKVSPDRRPSTSFAVIFDAGSSGSRVHVFRFDQNLDLLPIGKDLELFLQIKPGLSAYAQN
PQQGAESLMSLLDKAESVVPREFRPKTPVRVGATAGLRALGADASDKILQAVRDLLKLRS
TLNSQPDAVTVLDGTQEGAFQWVTINYLLGNLGKDYSETVGVVDLGGGSVQMAYAISETD
AAKAPKVSVGEDPYVKEMFLRGRKYYLYVHSYLGYGLLAARAKILKVLDGSGNPCILDGF
DGSYNYGGKSFKASSSPSGASLNECKSIAHKALKVNGSTCTHMKCTFDGIWNGGGGDGQK
NLFVASFFFDRAAEAGLADPSLPVVKVRPTDFEEAAKQACQTKLEDAKSTYPSVEEGNRP
YLCMDLVYQYTLLLVGFGLDPWQEITLVKKVKYHDYLVEAAWPLGSAIEAVSSA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcgctccgggcgccccccgccgccgccggcggagtccctcttcgacaggatc
taccagctccggggagccttcctgatggtggccgtgcctctccttctggtgaccatggtg
ctctacttcacgccctccgcctcctccaacgagtccatcgaggactacgccctcacgcac
cgcaaggtctcccccgatcggaggccctccacctccttcgccgtcatcttcgacgccggc
agctccggcagccgcgtccacgtcttccgcttcgaccagaacttggatctccttcccatt
gggaaggacctcgagctcttcctacagattaagcctggtttgagtgcgtatgcacagaat
ccacaacagggagcggaatctttgatgtctcttttggataaagcggagagtgttgttcct
cgggagtttcggccaaagacacctgttagagttggggcaactgcaggtttaagggctttg
ggagcggatgcttctgacaagatcttgcaagcggttcgggatttgcttaagctaagaagc
actctaaactctcagcctgatgcagtaactgtgctggatggaacacaagaaggtgctttt
caatgggtgactattaactatctactgggaaacttgggaaaagattattcagaaactgtt
ggggtagttgatcttggaggtggatctgttcagatggcatatgccatctctgagacagat
gctgccaaggctccaaaagtatcagttggagaggacccatatgtcaaggagatgttccta
aggggaaggaaatattacctctatgttcacagttacttgggctatggtttactagcagct
cgtgcaaagattttaaaggttttggatggttctggaaacccttgcatcttagatggcttt
gacggatcttacaattatggaggaaaatcttttaaggcctcgtcctccccttctggcgca
agcttgaatgaatgcaaaagcatagctcataaggctctcaaggttaatgggtcaacatgt
acacatatgaagtgcacttttgatgggatatggaatggtggtgggggtgatggacagaaa
aacctttttgttgcctcatttttctttgaccgggcagctgaggctggtttagccgatcca
agcttacccgttgtgaaggttcgtcctacggattttgaggaagcagctaagcaagcttgt
caaacaaaacttgaagatgccaaatccacttatccaagtgtggaggaagggaaccgtcca
tatttatgcatggatctcgtataccagtatactttgcttcttgttggattcggcctagat
ccatggcaagaaattacgttagtgaagaaagttaaatatcatgattatcttgttgaagct
gcatggcccctaggcagcgctatagaagctgtatcatctgcataa

DBGET integrated database retrieval system