KEGG   Cajanus cajan (pigeon pea): 109813204Help
Entry
109813204         CDS       T04868                                 

Definition
(RefSeq) probable LRR receptor-like serine/threonine-protein kinase At3g47570
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
ccaj  Cajanus cajan (pigeon pea)
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccaj01001]
    109813204
Enzymes [BR:ccaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109813204
Protein kinases [BR:ccaj01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109813204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 109813204
NCBI-ProteinID: XP_020232936
Position
Unknown
AA seq 188 aa AA seqDB search
MASALDYMHHGASPTVVHCDVKPSNVLLDENMVAHLSDFGIAKLLDEGQSQEYTKTMATF
GYIAPEFGSKGTISPKGDVYSFGIMLMETFSRKKPTDELFVAGLSLKSWISESLPHAITR
TVDSNLLQDEEHRADDIISSISSIYRIALNCCADLPEDRMNMTDVAASLSKIKVMFPEKY
RPTQANTI
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgcattggattacatgcatcatggtgcttcgccaactgtggttcattgcgat
gtaaaacctagtaatgtcttattggatgaaaacatggttgctcatctcagtgactttggc
attgccaaacttcttgatgaaggacaatcccaagaatatactaagaccatggcaacattt
ggctacattgcaccagagtttggatccaaggggactatttctccaaaaggagatgtatac
agttttgggattatgttgatggaaacattctcaagaaagaagccaacagatgagttgttt
gttgcaggattgagcttgaaaagttggattagtgaatcattaccccatgccattactcga
actgtggattccaatttgttacaggatgaagaacatcgtgctgatgacataatatcatct
atttcatctatttatagaatagccctgaattgctgtgcagatttgcctgaagatcgaatg
aatatgactgatgttgctgcatcgttaagcaaaatcaaagtcatgtttccggaaaagtac
aggccaacacaagcaaatacgatctaa

DBGET integrated database retrieval system