KEGG   Cajanus cajan (pigeon pea): 109813336Help
Entry
109813336         CDS       T04868                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109813336
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ccaj03041]
    109813336
Enzymes [BR:ccaj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     109813336
Spliceosome [BR:ccaj03041]
 Complex C
  Other components
   Step II factors
    109813336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind S1 Helicase_C DEAD AAA_22 AAA_19 AAA_30 T2SSE AAA Sigma54_activ_2 Flavi_DEAD AAA_16 ABC_tran AAA_14 PhoH
Motif
Other DBs
NCBI-GeneID: 109813336
NCBI-ProteinID: XP_020233085
Position
Unknown
AA seq 1222 aa AA seqDB search
MAVDNPEDGLKKLEYLSLVSKVCTELESHTGTGDKVLAEFITELGRSSENVEEFDTKLKE
NGAEMPDYFVRTLLTIIHAILPPKPKDLKKEKESSTGKTKFKALAIADDRDRAKELQKEL
ESEARGKQKERIEEDDGYRDRDRDRRDRRRDRYGRDRDDEDDRRDYSRRGRDRDDEDDRR
DHGRRGRDRDDEDDRRGQGRRRRDRDDEDDRRDYGRRGRDRDRYDGDQDRHERHRRDGYE
EDDGRGRENGDRDSGNRKGSRNGSGEPELYAVYKGRVSRVMETGCFVQLDDIRGKEGLVH
VSQMATRRITNAKDVVKRDQEVYVKVISVSGQKLSLSMRDVDQHTGKDLLPLKKSSEDDT
LRMNPQDSKDGPVARTGLSGIRIVEEDDVGSSRRPLKRMSSPERWEAKQLIASGVLSVSE
YPTYDDEGDGLLYQEEGAEEELEIELNEDEPAFLQGQSRYSMDMSPVKIFKNPEGSLGRA
AALQSALIKERREVREQQQRTMLDSIPKDLNRPWEDPMPESGERHLAQELRGVGLSAYDM
PEWKKDAYGKTITFGQRSKLSIQEQRQSLPIYKLKKELIQAVHDNQVLVVIGETGSGKTT
QVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDT
VIKYMTDGMLLREILVDENLSQYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPELRLIVT
SATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDAALITVLQIHLTEPEGDV
LLFLTGQEEIDFACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFEPAPPGKRKVV
VATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQRAGRAGRTGP
GKCYRLYTESAYRNEMSPTTIPEIQRINLGMITLNMKAMGINDLLSFDFMDPPSPQALIS
AMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGN
IFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQ
DVRKQLLTIMDKYKLDVVNAGKNFTKVRKAITAGFFFHAARKDPQEGYRTLVENQPVYIH
PSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVELAPRFFKVADPTKMSKRKRQE
RIEPLYDRYHEPNSWRLSKRRA
NT seq 3669 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggataatcctgaggatggattgaagaagctagaatacttgtcgttggtgtcg
aaggtgtgcactgaattggagtcccacactggcaccggtgacaaggttctcgccgagttc
atcaccgagttgggtcgatcatcggagaacgttgaggaattcgacacgaagctgaaggag
aacggtgcggagatgccggattactttgtccgaacgctcctcacaattattcacgccatt
ctccctcccaagcccaaggatttgaagaaggagaaagagagtagcaccggcaagaccaag
ttcaaggctctggctatcgcagacgatagagaccgggccaaggagcttcagaaggagtta
gaatctgaggccagaggaaagcagaaagaacgaattgaggaagatgatgggtacagagat
agagatagggataggagagataggcgcagagataggtatggaagagacagagatgatgaa
gatgataggagggattacagcagaagaggaagagatagagatgatgaagatgatagaagg
gatcatggaagaaggggaagagatagagatgatgaagatgatagaaggggtcagggcaga
aggagaagagatagagatgatgaagatgatagaagggattatggcagaagaggaagagat
agagataggtatgatggggatcaagatagacacgagaggcacagaagagatggatatgaa
gaggatgatgggcgtggaagggagaatggggatagagatagtggtaataggaagggttca
cggaatggttctggtgaacctgaactgtatgcagtttataaagggagggtgtcaagggta
atggagactggatgctttgtccagttagatgacattagagggaaagaagggttggtacat
gtttcacagatggccacccggaggattacgaatgccaaggatgttgtgaagagggaccag
gaggtttatgttaaagtaatttcggtttcaggtcagaagttgtctctttccatgagggat
gttgatcagcatactggcaaggatcttcttccattgaagaagagctccgaggatgataca
ctgaggatgaatccgcaagactcaaaggatgggccagttgctaggacggggctttcgggt
atcagaattgtggaagaagatgatgttggttcttcacggagacccttgaagagaatgagc
tctccggaaagatgggaagctaaacagttgattgcttcaggtgtcttgagcgtttctgag
tatccaacttatgatgatgagggggacggattgttgtaccaagaggaaggtgctgaggag
gagcttgagattgagttgaatgaggatgaacctgccttcttacaagggcagagcagatac
tcaatggacatgtctcctgttaagatttttaagaatcctgaaggttctctgggtcgagct
gctgcactccagtctgcacttataaaggagcgtagggaagtgcgagaacaacaacaacgc
acaatgcttgattcaattccaaaggatctcaatcgaccttgggaagaccctatgccagag
tcaggtgaaaggcatcttgctcaggagcttagaggtgttggcttatcagcctatgatatg
ccggaatggaagaaggatgcctatgggaaaaccattacctttgggcaaagatcaaagctt
tctattcaggagcagaggcagagtttgcccatttacaagttaaaaaaagaattgattcag
gctgtgcatgataatcaggtgttggtagtcattggagaaactggctcaggtaagactact
caagtcacacagtatcttgctgaagcaggatacactacaagaggcaaaattggatgtact
caaccacgtagggtggctgcaatgtcagttgcgaagagagttgcagaagagtttggttgt
cgattgggagaggaagttggttatgccattcggtttgaggattgcactggaccagatact
gttatcaagtacatgacagatggtatgcttcttagggaaatattggttgatgagaatctg
tctcagtattctgttataatgcttgatgaagcccatgaacgaactattcacaccgatgtt
ctatttggactgctgaagcagttagtaaaacgcagaccagaattgcggttgattgtcaca
tctgctacgctggatgctgagaagttttcaggatatttctttaactgtaacatcttcacc
attcctggtagaacttttcctgtggagatactttataccaaacaacctgaaagtgattac
ctagatgcagctttaatcactgtcctacaaatccatttgacagagcctgaaggagacgtt
cttcttttcttgactggtcaagaagaaattgattttgcatgccaatctctctatgaaaga
atgaaaggattaggtaagaatgttccagagctgatcattttaccagtttacagtgcactt
cctagtgaaatgcaatctaggatatttgaacctgctcctcctgggaaaaggaaagtggtt
gtggctactaacattgctgaggcatctttgactattgatgggatattttatgtgattgat
cctggatttgctaagcaaaatgtttataatccaaagcaaggtcttgattccttggtaata
actccgatttcacaagcatcagccaaacaaagagctggacgtgcagggcgtaccggacct
gggaagtgttatcgcctatatactgagagtgcatataggaatgagatgtctcccaccaca
attcctgagattcaaaggataaatctggggatgattactcttaatatgaaagctatgggg
ataaatgatttactgtcctttgattttatggatccaccatcaccccaagcactgatttct
gccatggagcagctttacagtcttggagcattggatgaagagggtcttttaaccaaatta
gggagaaaaatggcagaatttcccttggatccaccattgtccaagatgttacttgcaagt
gtagaccttggatgcagtgatgagattttgaccataattgccatgatccagaccggaaat
attttttacaggccaagggaaaaacaagcccaagcagatcagaagagggcaaagtttttc
cagccagagggtgaccatcttaccctacttgctgtttatgaggcttggaaagccaagaat
ttttctggaccctggtgttttgagaactttgttcaatcccgatcattgagaagagcgcag
gatgtcagaaaacagctcctcaccatcatggataagtacaaattggatgtcgtaaatgct
ggaaaaaacttcaccaaagtcaggaaagctatcactgcaggattctttttccatgctgct
agaaaggacccccaggaaggttacagaacccttgttgagaaccagcctgtgtatatccat
ccaagttcagctttgttccagagacagcctgactgggtcatttaccatgagcttgtgatg
acaactaaggaatatatgcgtgaggtcactgtcatagacccaaaatggcttgttgaattg
gctcccagattcttcaaagtggcagatcctacaaagatgagcaagcgaaaacgtcaagag
cgaattgaaccactatatgatagataccatgagcctaattcgtggcgtttgagtaaacgc
cgagcatga

DBGET integrated database retrieval system