KEGG   Cajanus cajan (pigeon pea): 109817582Help
Entry
109817582         CDS       T04868                                 

Definition
(RefSeq) guanine nucleotide exchange factor SPIKE 1-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ccaj  Cajanus cajan (pigeon pea)
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccaj04131]
    109817582
Membrane trafficking [BR:ccaj04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    109817582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOCK-C2
Motif
Other DBs
NCBI-GeneID: 109817582
NCBI-ProteinID: XP_020238449
Position
Unknown
AA seq 229 aa AA seqDB search
MLIVLNFAMFHAFDFRTTTRNEPFLQLFHCLYVYPLTVSLGRKRNLFIRVELREDDGDIR
RQPLEAIYPRDPGLDASFQKWGHTQVAAGARVACYHDEIKLSLPATWTPNHHLLFTLFHV
DLQTKLEAPKPVVIGYTALPLSSHAQLRSEINLPIMRELVPHYLQDAGRERLDYLEDGKS
VFRLRLRLCSSLYPINERIRDFFLEYDRHTLRTSPPWGSELLEISFYIC
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgttgatagtgcttaattttgctatgttccatgcttttgacttccgcactacaacaaga
aacgagccttttttgcaactttttcactgcctgtatgtgtatccgttgactgtaagtttg
ggtaggaaaaggaatttgtttatacgggttgaactcagggaggatgatggtgatattcgt
aggcagccattggaggcaatatatcctagagatccaggtctagatgcatcatttcagaag
tggggtcacacccaagttgctgctggggctagggttgcttgctaccacgatgaaattaaa
ctttcccttcctgctacgtggacgccaaatcaccaccttttatttactttatttcatgtt
gatctgcaaacaaaattggaagctcctaagccagtggttattggatatacagcacttcct
ttatcatcccatgctcagctgcggtcggaaataaatcttccaattatgagagaattggtt
cctcattatctccaggatgcaggacgggagagattggattatttggaagatgggaaaagt
gtcttcagattgcgtttaaggctatgttcttctttataccctatcaatgaacgcattaga
gatttctttcttgaatatgatcggcacactcttcgaacaagtccgccatggggttctgaa
cttctggagatatcattttatatatgttga

DBGET integrated database retrieval system