KEGG   Cajanus cajan (pigeon pea): 109818199Help
Entry
109818199         CDS       T04868                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 1 isoform X1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00260  Glycine, serine and threonine metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    109818199
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     109818199
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Pyridoxal_deC Aminotran_3 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 109818199
NCBI-ProteinID: XP_020239205
Position
Unknown
AA seq 413 aa AA seqDB search
MQFSIKFLEYVCTTDKVASIILVSLAILLEYLVWYQLQMVRIHTFAFRLVFVAEKMVARM
VDLRSDTVTKPTEAMRAAMASAEVDDDVLGRDPSCFLLESEMAKIFGKEGAIFVPSGTMG
NLISVLVHCDIRGSEVILGDNSHIHIYENGGIATIGGVHPRTVKNNEDGTMDIDLIEAAI
RDPKGELVYPTTRLICLENTHGNSGGRCLSVEYTDRVGEVAKKHGLKLHIDGARIFNASV
ALGVPVDRLVQAADSVSVCLSKGLGAPVGSVIVGSNSFITKARRLRKTLGGGMRQVGILC
AAALVALQENVGKLESDHNKAKLLADGLNEIKGLRVDTSSVETNIIYVEIEEGSRTTAAK
LCKDLEDYGILLMPMSLSRLRIVFHHQISASDVQYALSCFEQAVNGVRNENGN
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcagtataaagttcttggaatacgtgtgtactacagataaagttgcctcaata
atactggtgtcacttgcaatcttgttggagtatctggtttggtaccaattgcaaatggtg
agaatacatacatttgcctttaggcttgtttttgtggcagagaaaatggtagctagaatg
gtggatcttcggtcagatacagtgacaaagccaactgaagcaatgcgagctgctatggcg
agtgctgaggttgatgacgacgttcttggccgtgacccctcttgttttctcttagagtca
gagatggcaaagatatttggaaaggaaggtgcaatttttgttccatcaggcacaatgggg
aaccttatatccgtgcttgtgcattgtgacataaggggaagtgaagttattctgggagac
aattcccacatacacatttatgagaatggaggcattgcaaccattggaggggtccatcca
agaacagtaaaaaataatgaagatggaaccatggacattgatttgattgaggctgccatc
agagatccaaagggagagctagtgtatccaaccacaaggcttatttgcttggaaaatact
catggaaactctggtggtagatgtctttcagttgaatatacagacagagtgggagaggtt
gctaaaaaacatggactgaagcttcacattgatggagcccgtatatttaatgcatcagtt
gcactcggtgtccctgtggataggcttgttcaagcagctgattcggtatcggtatgtcta
tcaaaaggcctgggtgctccagttggatctgttattgttggttccaatagctttatcacc
aaggctagacggctccgaaaaaccttaggtggtggaatgaggcaggttggtatcctttgt
gctgctgcacttgttgctttacaggaaaatgttggaaagctagaaagtgatcacaataaa
gctaaacttttggctgatggattaaatgaaattaaaggactaagagtggatacctcttct
gtggaaaccaatattatatatgttgaaattgaagagggctcaagaactacagcagcgaaa
ctatgcaaagacttggaagactatggtatcttactgatgccaatgagcttatcaagattg
agaattgtcttccaccaccaaatatcagcaagtgacgtgcagtatgccttgtcgtgcttt
gagcaagctgtcaatggagtacgaaatgaaaatggcaactag

DBGET integrated database retrieval system