KEGG   Cajanus cajan (pigeon pea): 109818351Help
Entry
109818351         CDS       T04868                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP]-like
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00020  Citrate cycle (TCA cycle)
ccaj00480  Glutathione metabolism
ccaj01100  Metabolic pathways
ccaj01110  Biosynthesis of secondary metabolites
ccaj01200  Carbon metabolism
ccaj01210  2-Oxocarboxylic acid metabolism
ccaj01230  Biosynthesis of amino acids
ccaj04146  Peroxisome
Module
ccaj_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109818351
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109818351
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109818351
Enzymes [BR:ccaj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     109818351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 109818351
NCBI-ProteinID: XP_020239385
Position
Unknown
AA seq 85 aa AA seqDB search
MLLAFANKWPHYLSTKNTILKKYDGRYDHRLIDDMVAYALKSEGGYVWACKNYDDDVQSE
LLAQGFGSLGLMTCAAIFLWQDIGS
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgttactggcatttgcaaataaatggccacattacttgagcaccaaaaacacaattcta
aagaaatacgatggcaggtatgaccataggctaattgatgacatggtggcgtatgcactc
aagagtgaaggtggatatgtttgggcttgcaagaattatgatgatgatgtccaaagtgaa
ttacttgctcaaggatttggctcgttgggtctcatgacttgtgctgctatcttcttatgg
caagacattggaagctga

DBGET integrated database retrieval system