KEGG   Ceratina calcarata (carpenter bee): 108622764Help
Entry
108622764         CDS       T06061                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: heat shock 70 kDa protein cognate 4-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ccal  Ceratina calcarata (carpenter bee)
Pathway
ccal03040  Spliceosome
ccal04141  Protein processing in endoplasmic reticulum
ccal04144  Endocytosis
ccal04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:ccal00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108622764
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108622764
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108622764
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    108622764
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccal01009]
    108622764
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ccal03041]
    108622764
   03009 Ribosome biogenesis [BR:ccal03009]
    108622764
   03110 Chaperones and folding catalysts [BR:ccal03110]
    108622764
   04131 Membrane trafficking [BR:ccal04131]
    108622764
   03051 Proteasome [BR:ccal03051]
    108622764
   03029 Mitochondrial biogenesis [BR:ccal03029]
    108622764
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccal04147]
    108622764
Protein phosphatases and associated proteins [BR:ccal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     108622764
Spliceosome [BR:ccal03041]
 Complex B
  Other components
   Prp19 complex
    108622764
 Complex C
   Prp19-CDC5 complex
    108622764
Ribosome biogenesis [BR:ccal03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    108622764
Chaperones and folding catalysts [BR:ccal03110]
 Heat shock proteins
  HSP70 / DNAK
   108622764
Membrane trafficking [BR:ccal04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    108622764
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    108622764
Proteasome [BR:ccal03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    108622764
Mitochondrial biogenesis [BR:ccal03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    108622764
Exosome [BR:ccal04147]
 Exosomal proteins
  Proteins found in most exosomes
   108622764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 108622764
NCBI-ProteinID: XP_017876333
Position
Unknown
AA seq 622 aa AA seqDB search
MAAPAVGIDLGTTYSCVGVFINGKVEIIANDQGNRTTPSYVAFTEAERLIGDAAKNQVAM
NPTNTIFDAKRLIGRRFDDPSVQSDMKQWPFTVINDGGKPKIKVQYKKETKSFFPEEISS
MVLTKMKETAEGFLGKSVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI
AYGLDKKGRGERHVLIFDLGGGTFDVSILTINDGIFEVKSTAGDTHLGGEDFDSRMVTHF
SQEFSRKFKKDLTKNKRALRRLRTACERAKRTLSSSTQANIEIDSLLDGIDFYTSITRAR
FEELNQDLFKNTLQPVEEALRDAKMDKGKIHDIVLVGGSTRIPRIXXXXXXGKELNKSIN
VDEAVAYGASVQAAILQGSDMVQDLLLLDVTPLSLGIETAGGVMTTLIKRNTTIPTKQTQ
TFTTYSDNQPSVLVQVYEGERVMTADNNLLGKFELSGIPPAPRGMPQIEVTFDIDANGIL
NVSAIEKSTNKENKITITNDKGRLSKEDIERMVNEAERYQQEDQTQKDRIAAKNNLESYC
FNMKNTVDDDKVKGKIADGDRKRISDKCNEIIKWLDTNTTATKDEFERKLKDAEKICKPI
ITKFYGSAGARIPDGPTIEEVE
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaccggcagtgggcatcgacttgggtaccacatactcttgcgtcggggtgttc
atcaatggaaaggttgaaatcatcgctaatgaccaagggaaccgcaccacgccgagttat
gtcgcgtttacagaagcggaaaggttaattggcgatgcagccaaaaaccaagtagctatg
aatcccacaaacacgattttcgacgcgaagaggctgatcggcagacgcttcgacgatcca
tcagttcaatctgacatgaaacagtggccgttcaccgtgattaacgacggagggaaacca
aaaatcaaagttcaatacaaaaaagagacgaagtcgttcttccctgaggagatctcgtcg
atggtgttgacgaaaatgaaggaaaccgcggaaggctttctgggaaaatctgtcacaaac
gctgtaatcacggtgccggcgtactttaacgattctcaacggcaagctaccaaagacgcc
ggtactatctcaggcttgaacgtcctaaggatcattaacgagccgactgcggccgctatt
gcttatggtctcgacaagaagggacgcggtgaaaggcacgttctgatctttgatcttggt
ggcggtactttcgatgtatcgatactaactattaacgacggtatattcgaagtaaaatca
actgcgggtgatactcatttgggtggcgaggatttcgatagccgtatggtaacacacttc
tcgcaagagttctcgaggaagttcaaaaaggatctgacgaagaacaaacgggcacttcgg
cgattgagaacagcatgcgagcgcgccaagagaacattgtcctcttcaactcaagccaat
atcgaaattgactcattgctcgatgggatcgacttttatacatccattactcgcgctcgc
ttcgaagagcttaatcaggatctcttcaagaacacactgcagcctgtcgaagaagctctt
cgcgatgctaagatggacaagggaaaaattcacgacatcgtcctcgtcggtggctcaacg
aggattccacgaatanncannnnnnnnnnnnnngggaaggaattaaacaaatctataaat
gtggacgaagctgtggcgtacggagcgtctgtgcaagcggctattttgcaaggttccgat
atggttcaagatctactgcttcttgacgtgaccccgctgtccctggggatagagactgcc
ggtggcgtgatgactaccctcatcaaacggaacaccacaattcccaccaaacaaacgcag
acgtttactacttactcagacaatcagccgagcgttttggtccaggtttacgagggcgag
agagtcatgaccgcggacaacaatctgttgggcaagttcgagctttccggaatcccgccg
gcacctcgaggcatgcctcagatagaagtgacttttgatattgatgcgaatggaatactg
aatgtgtcagctatagagaagtcgacgaacaaggagaataagataacgataactaatgat
aaggggcgactcagtaaagaggatatcgaacggatggtgaacgaggctgagaggtaccaa
caggaagaccaaacgcaaaaagacaggatcgcggcaaagaacaatcttgagtcgtattgc
ttcaacatgaagaacacggtagacgacgacaaggttaaagggaaaatcgcggatggcgac
cggaaacgcatctcggacaagtgcaacgagattatcaaatggctggataccaacaccact
gccactaaggacgagttcgagcgcaagctgaaagatgctgaaaaaatttgcaagccgatc
attacgaagttttatggcagtgccggtgcaagaattcctgatggcccgacgatagaagaa
gtggaataa

DBGET integrated database retrieval system