KEGG   Ceratina calcarata (carpenter bee): 108625258Help
Entry
108625258         CDS       T06061                                 

Definition
(RefSeq) plancitoxin-1
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
ccal  Ceratina calcarata (carpenter bee)
Pathway
ccal04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ccal00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    108625258
Enzymes [BR:ccal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     108625258
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNase_II
Motif
Other DBs
NCBI-GeneID: 108625258
NCBI-ProteinID: XP_017880591
Position
Unknown
AA seq 377 aa AA seqDB search
MFTLFYIITALIICNVTNGDLNNKLQCRDENNAAVDWYVLYKLPKVHTSSNPLIREGHAY
LYITNATIESGWRLSTKSIGSNDSIPGITLAPLYNRSSEEDALWNLYNDSPPNASYVWNH
GHTKGVVMVNSDQGFWLIHSVPSFPPVPRAGVQTRPLNLENVTIEGAYSYPDSGTFYGQS
FLCVSLGGDQFNIVGEQLMYNEIGVYAKNIPEILGKQYPALKNATNQKRIKQPPYNHKAL
ITTLGSLELTSFAKSGKWGKDLYGDFVAPQLQSDLYVQSWLNGRGKLPTTCHRRKIYNVK
TLKVDAANVDFPSSRDHSKWAITVNTKSSNHWACIGDINRADTQYSRGGGTVCFEDDRLW
RDYRDIVNDVEPCHNTY
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtttactctgttctacataataacggcattaataatatgtaatgttacaaacggtgat
cttaacaataagttacagtgcagagacgaaaataatgcagcagtagattggtatgtgctt
tacaagttaccaaaagttcatacgagcagtaatcctctgattagagaaggtcatgcttat
ctgtacataacaaatgcgacgatcgaatctggttggcgattgtcgaccaaatccatcggt
tctaacgattctatccctggaatcacattagcgccgctttacaatcgtagcagcgaggag
gatgctttatggaatttatataacgatagcccgccgaacgcatcgtacgtgtggaaccat
gggcatacaaaaggtgtagtgatggtaaatagtgatcagggcttttggttaattcatagc
gttccgagttttcctccggtgccgagagccggtgtgcaaactcggccgttaaacctggaa
aatgtaactatcgaaggcgcgtacagttatccggatagcggcacgttttacgggcaaagt
tttttatgcgtttctctcggcggcgatcagttcaatatcgtcggcgaacaattaatgtac
aatgaaatcggggtgtacgcgaagaatataccagaaatccttggcaagcagtatccagcg
ttaaagaacgcgactaatcagaagcgcattaaacagcccccttacaaccataaagctctg
ataacgacgttgggatctctcgaacttacctcgttcgccaagtccggaaaatggggaaaa
gatctctacggtgatttcgttgcgccacaattgcagtcggacttgtacgtccaatcgtgg
ctgaacggccggggtaaactgccgacaacttgtcatcgtagaaaaatatacaatgtaaaa
actcttaaagtcgacgcggcaaacgtagactttcctagtagccgcgatcattccaaatgg
gccatcacggtcaacacaaaatcatcgaatcattgggcttgtattggcgatattaacaga
gctgacacgcagtattctcgaggcggtgggaccgtgtgctttgaggacgaccgtttgtgg
agagattatcgcgacattgtgaatgacgtggagccttgtcacaatacgtattga

DBGET integrated database retrieval system