KEGG   Ceratina calcarata (carpenter bee): 108625643Help
Entry
108625643         CDS       T06061                                 

Definition
(RefSeq) autophagy-related protein 16-1 isoform X2
  KO
K17890  autophagy-related protein 16-1
Organism
ccal  Ceratina calcarata (carpenter bee)
Pathway
ccal04136  Autophagy - other
ccal04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:ccal00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108625643
   04136 Autophagy - other
    108625643
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccal04131]
    108625643
   03029 Mitochondrial biogenesis [BR:ccal03029]
    108625643
Membrane trafficking [BR:ccal04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    108625643
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    108625643
Mitochondrial biogenesis [BR:ccal03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    108625643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Ge1_WD40 HOOK DUF4201 Nup160 Cytochrom_D1 Cluap1
Motif
Other DBs
NCBI-GeneID: 108625643
NCBI-ProteinID: XP_017881300
Position
Unknown
AA seq 552 aa AA seqDB search
MAASEPSVSLPSREDNNWRKDVILQLQDRNRRQTYCFTDLISLHNRLFESTNTLRGENIQ
LTITNETLRREAVSGTLGLNVNSDLEARLLKQAEELATLHKRKGEHTQQIVDLNNKLQEV
TKELQAKETSLAESLELNANLRLEMSKCVSRERELESVNQMLKDEHQALQLAFASLEEKL
RKAQEENRLLVERLIKYKTRDAEKVNEENDNFLKKRQAKVQRELEDAARDTRPVSPDRSS
LKEGIAGLPTAVPTKVSVTFTAHDGEVFAVKWSPAERILATGGADRKVKLWNISKGASES
KGILVGSNAGVMCVDFDSTGTLILGASNDYASRVWTVNDFRLKHTLTGHCGKVMAAKFLG
EPSKVVTGSYDRTLKIWDLRSKACIETKFAGSSCNDLVTSDGAGSTIISGHFDQRIRFWD
TRAESSSNDILLEGKVTSLDLSRGANYLLSCVRDDTLKLIDLRMKKIIGSFSADGFKVGF
DWTRATFSPDGQYIAVGSADGSVFIWSVATNTIESVLKNHSAVVTAVSWHPHGTYLASVD
RAKMVTVWGDHV
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaagtgaaccaagtgtgtcattaccatctagagaagataataattggagaaaa
gacgtaattttacaattacaagataggaataggaggcaaacatattgttttacggatctt
attagtttacataacagattgtttgaaagtacaaatactttacgtggagaaaatatacaa
cttacaataacaaatgaaactctccgtcgtgaggctgttagtggaactcttggattaaat
gtgaattctgatcttgaagctcgtctcttaaagcaggcagaagaattagcaacgctacac
aaaagaaagggagaacatacgcaacaaatagtagatcttaataataaattacaagaagtg
accaaggagcttcaagctaaagaaacaagtcttgctgaaagcctggaactcaacgccaat
ttacgtctagagatgtccaaatgtgtgagcagagagagagaattagaaagtgtcaatcaa
atgttaaaagacgagcatcaagctttgcaactcgcttttgcatctttagaagagaaactc
aggaaagcacaggaagaaaatcgtctgttagttgaacgcttaatcaagtacaaaactaga
gatgctgagaaagtaaatgaagaaaacgacaactttttaaaaaaaagacaagcaaaggtg
caaagggaacttgaggacgcagcacgtgacacgcgaccagttagtccggataggtcaagc
ttaaaagaaggcattgctggtcttcctactgcggtaccaacgaaagtgtccgtcacgttt
actgcacacgacggagaagttttcgccgtaaaatggtctcccgccgagaggatcctcgct
accggcggagccgacaggaaagtgaagctctggaatatctcgaaaggtgcctcggaaagc
aaaggtattctcgttggcagtaatgcaggagtgatgtgcgtcgattttgattccacgggg
acgctgatccttggagcatcgaacgactacgccagccgggtgtggactgtcaacgacttt
cgactaaagcacacgctaacgggccactgcggcaaggtgatggcggcgaagtttcttggc
gagccttcaaaagtagttactggcagttacgatcgtaccctaaaaatttgggacctgcgt
agcaaagcatgtatagaaacgaagtttgcgggctcgagttgcaacgaccttgtaacttcc
gatggagcaggctctacgataattagtggccattttgatcagagaattcgattttgggac
accagggcagagtccagctcaaatgatattctgttggaagggaaagtcacgtcactggat
ttatctcgtggtgcgaattatcttttaagctgtgtcagggacgatacgttgaaactaatc
gatctccgaatgaaaaaaatcatcggatcattcagcgccgacgggtttaaagttggcttc
gattggacgcgggcgactttcagtcctgacggtcaatacatagccgtcggctctgcggat
ggatcggttttcatttggtccgtcgcaacaaatacaattgaatccgtattgaaaaaccat
tcagccgtggtgacagcagtttcctggcatcctcacggtacctaccttgcatcggtggac
agggcaaaaatggtaacagtctggggcgaccatgtttaa

DBGET integrated database retrieval system