KEGG   Ceratina calcarata (carpenter bee): 108628981Help
Entry
108628981         CDS       T06061                                 

Definition
(RefSeq) 39S ribosomal protein L22, mitochondrial
  KO
K02890  large subunit ribosomal protein L22
Organism
ccal  Ceratina calcarata (carpenter bee)
Pathway
ccal03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ccal00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    108628981
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ccal03011]
    108628981
Ribosome [BR:ccal03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    108628981
  Bacteria
    108628981
  Archaea
    108628981
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 108628981
NCBI-ProteinID: XP_017886750
Position
Unknown
AA seq 209 aa AA seqDB search
MQTVRQCCQRLISTSKIFNPNTSCLSSIQRSYYGYRDGGKKDKGFLKYNDSVFPPQKPGE
EKRPGYVCHVKKNVKYSPLKMWYIACFVRGMTIDEAVKQLSFLKQKGAAIAKEVLLEAQR
MAVEEHNIEFKSNLWVAESFATKGAIIKGIRRHSRGRPGIVHYRYCNYYVRLEEGKPPKH
YYQPAPQSGEELLKEWMDQMHNRKIINSL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccgtgaggcaatgttgtcaacgactaatttcaacgtccaaaatattcaatcct
aatacaagttgtttatcaagtatacaaagatcgtattatggatacagagatggaggaaaa
aaggataaaggatttcttaaatataatgacagtgtcttccctccgcaaaaaccgggtgaa
gaaaagagaccaggttacgtttgtcatgtgaaaaagaatgtaaaatatagccctttaaag
atgtggtacatagcttgctttgtaaggggaatgaccatagatgaagctgttaaacaatta
agctttctgaagcagaaaggtgcagctatagcgaaagaggttcttttagaggcacaacgt
atggcagttgaagagcataacattgaatttaagagtaatttatgggtcgccgaatctttc
gcgacaaagggtgcaataataaaaggcataagaagacattccagaggaaggccaggaata
gtacattacaggtattgtaattactatgttcgtttggaagaaggaaaaccaccgaaacat
tattaccagccagcacctcagagtggtgaggaactattaaaagaatggatggatcaaatg
cataatcgtaaaataattaattcactgtaa

DBGET integrated database retrieval system