KEGG   Ceratina calcarata (carpenter bee): 108629477Help
Entry
108629477         CDS       T06061                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
ccal  Ceratina calcarata (carpenter bee)
Pathway
ccal03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ccal00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    108629477
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ccal03012]
    108629477
Translation factors [BR:ccal03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    108629477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 108629477
NCBI-ProteinID: XP_017887660
Position
Unknown
AA seq 1121 aa AA seqDB search
MARYGQRPENALKRANEFIEVGKPARALDTLQEVFRNKKWTYNWSESVLEPIMFKYLDLC
VELKKSHIAKEGLFQYRNMFQSVNVGSLENVIRGYLRMAEEKTNQARKQSQQAVIDIDDL
DNLATPESILLSAVSGEDAQDRSDRTILTPWVKFLWESYCQCLELLRTNAHVETLYHDIA
RMAFQFCLEYNRKTEFRKLCEKLRKHLEEICKLPALVSNVSMNRAETQQLNLETRLNQLD
SAIQMELWQEAFKSSEDVHGMMNLSKKLPVPKTMANYYQKLAMVFWKAGNYLFHAAALFK
LLQLSREMKKNMSLEEQQRMANRVLLATLSIPLPSAHPEFDRFIETDKSPLEKAQKLATL
LGLTQPPTRVSLLKDIVRLNIVNLASPQLQELYSWLEVEFHPLELCSRVDSVIQTLQADE
NSPLIQYIPALQDVTLVRLVHQISQVYQTIQFARLLELAKFTTDFHLERLLVDCVRYNDM
QIRINHGKKCVHFGVDLSEAQREDHPDGPVLQAMPSEQIRCQLVNMATVLHRAINVINPN
KKKVEREKLRCAMVAHYHETKMKEHQRILGRHKIIEERKEYIEHINTVREEEEMRRQEEL
QRQQMLAEQKRLEQEREERERKRQQSEIQQIKDRHLKEKMQQISQTSHGQKVLKKLDEDE
IKKLDAEQIAAREAEELQKERREMQQKLKSQEKRIDYLERAKRLEEIPLLEKAVEEKMEL
ARQQWEQQEAERIAAAIEERQQAVATRERMARMKEDHDNFMAKILAERKSIYLEKLKEFE
KMLNEERAARLLKRKMERKAERKAKWEKERAEAIERRRLEELRIKQEEEKRRMEEERTKR
EEEEKQRRAEEEAKEAERLAKIEKQAEITRAREAEIERKLEEERQKERELTDTWRRGGER
THRVQDKPVEMSWRRPLDAKDDGVKEESTRWKRRDATREADKWRKDDKDDRPKKDTVDRW
RTTKDDYDKDDTRDRDRERDRGERDRDRDRIDKDRGIDGRPIRDIPRDPISDGPRTRGRM
PDRRGGHERRDDRDDRRRDDRRDDRRDDRRDDRRDGRREDTTRNFGSQNWRDKNDAIQNS
SREMSRRLEKRDDVKEERLPPKQEERRRATEDDGWSHVSRR
NT seq 3366 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgatacgggcaaagacctgagaatgctctaaaacgagcaaacgaattcatagaa
gtaggaaaaccagctcgtgcattagataccttacaggaagtcttccggaacaaaaaatgg
acgtacaattggtcagagtcggtgttggaaccgatcatgttcaaatacttggacctttgc
gtggaactgaagaagtcccacatagcgaaggaaggcctatttcagtaccgaaatatgttt
caatcagtaaacgtaggaagcttggagaatgtgatacgcggatacttgcgtatggcggag
gagaaaacgaatcaggcacggaagcaaagccaacaagcggtgatagatatagatgatctt
gataatctggccacgcccgaaagtattttattatccgcggtcagtggcgaagatgcccag
gatcgtagcgatcgcacgatcctgacgccttgggtgaaatttctctgggaatcatactgt
cagtgcctggaattattgagaacgaacgctcacgtcgagacgttataccacgatatcgct
cgcatggcctttcaattttgtctcgagtataatcgtaagactgaattccgtaagctatgc
gaaaagctgcgcaaacatttggaggagatttgtaaattgccggcacttgtctcgaacgtt
tcgatgaacagagccgagacgcagcagctgaacttggaaacgcggctgaatcagctcgat
tccgcgatacaaatggaactgtggcaagaagcgttcaaatcctccgaagacgtgcacggt
atgatgaatttatctaagaagcttccggtaccaaaaaccatggccaattattatcagaaa
ttggccatggttttctggaaggcgggcaactaccttttccatgctgccgcgttgtttaaa
ttgctgcagctctcccgtgaaatgaaaaagaacatgtctttggaggaacagcaaagaatg
gccaatcgcgtgttattggccaccctgtctatcccactgccatcggctcaccccgaattc
gatcgttttatcgaaacggacaagagtccgttggagaaagcgcaaaaactcgcgaccctg
ttaggactgacgcagccgcccacgagagtatcgctgctcaaagatatcgtccgcctgaac
atagtaaatctagcgtccccgcaattgcaagaattgtactcatggttggaagtcgagttt
catcctctggaactctgcagccgtgtagactccgtgattcaaacactgcaggcggacgag
aatagtccgttgattcaatatattccagccttgcaagacgtcaccctcgtacgcttagtt
catcaaatatctcaggtttatcagactatacagttcgcccgacttttggagctcgccaaa
tttacgaccgacttccacctggagcgtctgttggtggactgcgtgagatacaacgacatg
cagataagaatcaaccatggaaagaagtgcgtgcatttcggagtcgatttgtcggaagcg
caaagggaagatcatccggacggtcccgttttgcaagcgatgccctccgaacagatacgt
tgccaacttgtgaacatggccaccgtcctacaccgagcgattaacgtgatcaatcctaac
aagaagaaggtggaacgtgagaaattgcgatgcgccatggtggctcattaccacgagacc
aagatgaaggaacaccagaggatcttgggcagacacaaaattatagaggagagaaaggaa
tatatcgaacatattaacacggttcgcgaggaggaagaaatgcgaagacaggaggaactg
cagagacagcagatgttggctgagcagaagaggctcgagcaagagagggaggagcgcgag
aggaaacggcagcagagtgagattcaacagatcaaggatcgtcatttgaaggaaaagatg
cagcaaatatcgcaaactagtcacggtcagaaggtgttgaaaaagttagacgaggatgag
attaagaagctagacgcggaacagatcgcagctcgggaggcggaagaattacagaaagag
cgcagggagatgcaacagaagttgaagtcgcaggaaaagaggattgactacttggaacgc
gcgaaacgtttggaagagataccgctgttggaaaaggctgtagaggaaaagatggaattg
gccagacaacagtgggagcaacaggaggccgaacggatcgccgcggccatcgaagaaagg
cagcaggctgtcgctactcgtgaacgcatggcgagaatgaaggaggatcacgacaatttc
atggcgaagattctggcagaacgtaagagtatttacttggagaagttaaaggagttcgag
aagatgttgaatgaggaacgggccgcaaggctattgaaacggaaaatggaacgaaaagcg
gaacgcaaggccaaatgggagaaggaacgagccgaggccatcgagagaagacgtctcgag
gaactacgtatcaaacaagaggaagagaaacgacgtatggaagaggagagaaccaagcga
gaagaggaggagaaacagagacgtgccgaggaagaggccaaggaagccgaacgcttggcc
aagatcgaaaagcaggcagagatcacaagagccagagaagccgagatagagagaaagctg
gaggaggagagacagaaggaaagagagttgacggacacgtggcgacgtggcggagagcgc
acccatcgcgtacaagacaaaccagtggaaatgtcttggcgccgtcctctcgacgcgaaa
gacgacggtgtcaaggaagaatctactcgctggaagagacgcgacgcgacgagagaagcg
gacaaatggcgaaaggatgataaggatgatagaccgaagaaagataccgttgatagatgg
cgaacgacgaaagacgactacgataaggatgacacaagggacagagacagagaaagggat
aggggcgagagggacagagatcgggatcgaatagataaagatcgcggtatagatggacgc
ccgatacgcgatattccgcgtgacccgatatctgatggacctcgtactcgcggtagaatg
cctgatcgtcgcggcggacacgaacgtcgtgacgatcgagatgatcgacgtcgagatgat
cgacgtgatgatcgtcgagatgaccgtcgcgatgatcgccgtgatggtcgacgcgaggat
acgacgcgaaatttcggcagtcaaaattggcgcgacaagaacgacgcgatacaaaattcg
tctcgggaaatgtcgagacggctcgagaagcgagacgacgttaaggaggagagacttcca
ccgaaacaagaggagagacggcgagctacggaggacgatggctggtcccacgtgagccgg
cgttaa

DBGET integrated database retrieval system