KEGG   Ceratina calcarata (carpenter bee): 108632464Help
Entry
108632464         CDS       T06061                                 

Definition
(RefSeq) methionine--tRNA ligase, mitochondrial-like
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ccal  Ceratina calcarata (carpenter bee)
Pathway
ccal00450  Selenocompound metabolism
ccal00970  Aminoacyl-tRNA biosynthesis
ccal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    108632464
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    108632464
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ccal01007]
    108632464
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ccal03016]
    108632464
Enzymes [BR:ccal01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     108632464
Amino acid related enzymes [BR:ccal01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   108632464
Transfer RNA biogenesis [BR:ccal03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    108632464
 Prokaryotic type
   Other AARSs
    108632464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f Tli4_N
Motif
Other DBs
NCBI-GeneID: 108632464
NCBI-ProteinID: XP_017892573
Position
Unknown
AA seq 634 aa AA seqDB search
MATFSRNIVRLSVLTFKNVSIITSNCNKRYIMMSRARLEKAVENLEKNPFFNKYADKIAR
FQQTSPEEFLQRVESQEKKLQQKKVRLSRSFPFLLRKRPPPWTHIQKSNFSDHAVKNMYI
TTPIFYVNAGPHIGHVYTAVLADAIARFNTMLGHSVFLCTGTDEHGTKVQKAANTAALPI
PEYCTRVSRQFQDVCDNFQVQYSRFIRTTETRHREAVHHFWNRLENNGHIYRGKYAGWYN
VSEEAFVSDKEVLHKSSATNAFTESGDVLEWTEEDGYKFRLTSFVDDLKYWLKDENVIQP
AMYRNSLVFWLDDLRDLSISRPVERVPWAIRTPSDESHTIYVWLDALVNYLTALGYPDKS
FTEFWPPVQVIGKDILKFHGIYWPAFLIAAGLEPPKKLVCHGHWVIQDKKMSKSKGNVIS
PSTAVRDFTEEGLRYFLLRQATLQADANYNKSKVRKVLNSELADTLGNLINRCFGPAINP
NKVLHNSAEYADILESDVARRNISSLEDLGEKAKKHYEEYNLHHAIEAVMDTLHITNQMF
EYHQPWCLIKCKDPDSLKELEAVISLALENLRVAALVLHPIIPKLTSELLEFLQVPMERR
TWNDTKPLHLTSASHSTRRHVPSENIMFFRKIKN
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggcaactttctcacgaaatattgtacgattatcggtactaacgttcaagaacgtttca
atcattacgagtaattgcaacaaaagatacatcatgatgtcccgagctaggcttgagaaa
gctgtagagaatctcgagaaaaatccttttttcaataagtacgctgataaaatagcgaga
tttcaacaaactagtccagaagaattcttgcagcgtgtcgaaagtcaggagaaaaagttg
cagcaaaagaaagtccgcttatcgaggtcattcccattcttactaagaaaacgaccacca
ccgtggacccatattcagaagagtaatttcagtgatcatgcggttaaaaatatgtacatc
actacgcctatattttatgtaaatgctggaccacatatcggacatgtttacacagccgtt
ttggctgacgccatagctagattcaacaccatgctaggacattccgtattcttatgcacc
ggtaccgatgaacacggcacgaaagtccagaaagctgcgaacaccgcggccttaccgatc
cccgaatattgtacccgggtctcgcgacaatttcaagacgtgtgcgacaatttccaagtt
caatattcaagattcattcgaacgaccgaaacgcggcatcgggaggcggttcatcacttt
tggaatcgtttagaaaataatggacacatttaccgaggcaaatacgcgggatggtacaat
gtatctgaagaagcgtttgtctcggacaaagaagtattacacaaatcatcagctacaaac
gcattcacagaatcaggagacgttttagaatggacagaggaggacggttataaatttcga
cttacttcatttgtagatgatctgaaatattggttgaaggacgaaaatgtaatacaaccg
gcaatgtatcgcaactctttggtcttctggttggacgatctacgagatttaagtatttct
agacctgtcgagagagtgccgtgggcgattcgtactccatccgacgagtctcatacgata
tacgtgtggttggacgcgttagtaaattacctaactgcgctgggatatccagataaatcg
tttacagaattctggccacctgtacaagtcataggaaaagatatattgaaattccatggc
atatactggccggcgttcttaattgccgctggcctcgagcctccgaagaaacttgtgtgt
cacgggcattgggtcattcaggataagaaaatgtccaagtccaaaggaaatgtgatctcg
ccgtccacagccgttcgtgattttacagaagaaggtctgaggtatttccttctgcgacaa
gctacgttacaagcagacgcaaattacaacaagtctaaagttcggaaagtgttgaattca
gagcttgccgatactttgggtaatttaattaatcgatgttttggtccggctataaatcca
aacaaagtgttacacaactcggccgaatacgctgacattttggagtctgatgtggctcgt
aggaacataagttctttggaagacctaggcgagaaagctaagaaacattacgaggaatac
aatcttcatcacgcgatagaagcagtgatggacacattgcatattactaatcaaatgttc
gaatatcatcagccgtggtgtttaatcaaatgcaaagatcccgattccttaaaagaactc
gaagctgtgatatctttggccctagagaatttacgagtggccgcactagtgttgcaccct
atcataccgaagctgacgtccgagctcctcgaattccttcaagtcccgatggagaggcgt
acttggaacgacacgaaaccgcttcatttaacgagcgcatcgcacagtacgagacgacat
gttccgtcagaaaatataatgttctttagaaaaataaagaattga

DBGET integrated database retrieval system