KEGG   Ceratina calcarata (carpenter bee): 108632877Help
Entry
108632877         CDS       T06061                                 

Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
ccal  Ceratina calcarata (carpenter bee)
Brite
KEGG Orthology (KO) [BR:ccal00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccal01001]
    108632877
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccal04131]
    108632877
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ccal04812]
    108632877
   04147 Exosome [BR:ccal04147]
    108632877
Enzymes [BR:ccal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108632877
Protein kinases [BR:ccal01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   108632877
Membrane trafficking [BR:ccal04131]
 Others
  Actin-binding proteins
   Others
    108632877
Cytoskeleton proteins [BR:ccal04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     108632877
Exosome [BR:ccal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108632877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig Titin_Ig-rpts V-set fn3 C1-set C2-set_2 Ig_6 Ig_4 BiPBP_C SH3_9 SH3_1 Ig_5 SH3_2 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 108632877
NCBI-ProteinID: XP_026666601
Position
Unknown
AA seq 19651 aa AA seqDB search
MKRQPPQQQQQQQQQQTSMQQQQQQQTVMQQQQQYTQQRTERQVTRQQITSQQRVQGEIV
MQTTPTVPTFTGRPGDPSPPVFEQIFKNARFAQGGNAIFEGRVRGNPKPNVSWTHKGAPL
LESWKFRMSYDDKTGAVTLQINQIGPGDEGEYTCSAKNQYGEAICSVYIQPEGFGPPPQQ
QLGGFKKEYAQSFQSTEQKSQTGTQSFQQRSYQQTIDKRSYVNGTSTSIEDFKVDTFEYR
LLRETEYRESITRRFVGESDAQISTTVDRSLGPVAPPQITQKPRSSKLVEGSDAVFTAKI
SGNPKPRLTWFKNGQRIRDSQRVETSYSNQQATLKIRMALPEDSGNYTLLSENPQGCTVS
SAYLAIESTDQVDQAYQTQRETVKPQQVETTGDESGKVLPPNFVRTCTDRDATEGKMTRF
DCRVTGRPYPEVTWYINGQQVANDLTHKILVNESGNNSLMITNVSRSDAGVVTCVARNKA
GETSFQCNLNVIEKEQVLAPKFVERFTTATVKEGEPVVFMARAVGTPVPRISWQKDGVPL
TPGPDVRISTDGSGASSLDIPYAKLSDAAWYQCTAQNVAGSTATRARLFVETPKGVAPEP
RRLNLPRPTKIIEPEPAPGPEVIYLRHVERAKPYLPPPEEDRVYPPPRFIIPLRDVHQIE
GGRIHFEARIEPVGDPTMRVEWYINGRALEASSRATSIFRFGFISLDLLSIVLQDSGEYL
CRVVSSTGVAESRATLSVTPRATIEQASQHPDSLQYIQQLEDYSKYQRQESVEDISSQRP
AFIRPLQDLGELQEGRNAHFEAQLTPVSDPTMKVEWFKDGRPITASSRITTIFNFGYVSL
NILHLRAEDAGSYTVRAVNRLGEAISSASLRVFARTSVTSDLGIPEQQRYIEAAEELEAY
QQALHLRYVQEQPEPTSPPEFKSPIKDQNSIREGGYAHFEARLEPVGDSELRVEWLKDGR
PVEASSRITTFFNFGYVALTIKYVTIHDVGIYTCRAYNRAGEAHTTAQLSVISKNDVIYD
SQHPTGLQKIQTLEDSSRYSRQVEEETRVIQAPRFLGNLKGTNKIVEGQRAHFEARVEPQ
SDLTMTIEWYHNGKPITAANRIQTYHDFGYVAIDILQVRSEDAGTYTVVARNALGQAQLS
ATMVIETRSGVDTSSMHRATYEKTQRLEESKFVEPQYHIEEISKSKPIFVQPLSDPKPVS
EGKNIHLECRLEPMGDPTMRVEWFQNGRPVTVGSRFRTYYDFGFVALDIVHSTVMDSGEY
TVRATNHLGTAHTSACVRVIGKSDIVTETQHEQSLEQIQMLEDSSRYRRTQQEEVTVMQP
PQFTRPLHNAETVELTNVHLECRLQPVGDATMKVEWFVNGRPVKTGHRFRPSYEFDYVAL
DILGVYPDDSGVYTCQARNQLGEAVTSCSVRVHAKKDLLLESQHPEGLERIQYLEDASRY
KRRELVDEVVNVKPRFITAPKNQENLREGQYAHFECKLEPVTDSNLKVEWYKNGRPVTIG
HRFRPIHDFGYVALDVIDLIAEDSGTYTCRAVNLVGSDEVSCTLTCRSTAQVLTDTQNEL
GLERIHYLEDRTKYQRREDIEETTTQAPIFTTSLNNVEIKEGQRAHFECRLIPVSDATMK
VEWFHNNKPVKAGSRFVETNSFGFVALDIMYAYPEDSGTYTCRAKNIIGEAITSATAVVH
SKKSIYTETQNEETLQRIHYLEDTSRYQRKTTTEEIVTQAPVFTMPIKDLRVAENQAAHF
EARVIPVGDSKLKVEWLRNGVPIAASNRVTTMHDFGYVALNMKYVNPEDSGTYTCRARND
LGEAVTSATLFVQSKAALQFESQHEGALQKIQALEDTSKYQRHEEEEIVVTEKPSFTVQL
NGPTHLVEGQSAHYECRIEPYPDPTMKVEWFHNGKPLSTGHRYRTTCDFGFAALDVLTVY
AEDSGTYTCQATNRLGSAKSSINLDVKSRASIIRDTQHESALKKIQYLEDDSRYKRVQDD
DLIIAEKPKFGRPLKNIEHLPEGKSAHLEATLTPVNDPTMVVEWFRDGRPIPQGHKFKTT
YDFGYVALDILYAYPEDSGTYMCKARNAVGEAVTTCVISVDSKQGLYLDTLDAQRLQKIR
ELETVEVKQEVEKEVVHQKPVFLTPLNNLDHLKEGEHAHLECRVEPINDPNLKIEWFVNG
KAVKTGHRFRKTHDFGYVALDILYTYAEDSGTYMCKATNLAGEAVNTCTIKVGSRRSILL
DTQHPDGLEKIRELEAQGRPARLEVEEPPVTPPRFVTELRGTTEVYEGQTAHFECQIEPL
HDANLRIEFFHNGKPLPSASRFHVTFDFGYVALDIGHAVPEDAGQYSVRAINALGQCVSS
IELKVIPRDNIILDSQRPEGLDKIRELESQQPWKRPEVPEPQTRQRPVFTQPLQNIDAIP
EGHTAHFECRLIPVGDPTMKVEWFRNEIPLETSSRITKVHDFGYVSLDISHVREEDEGVY
MCRATNALGEAVTTASMKIRSKASIQMDTQHPEAQRKIAQLEADKPQRPEEPEKTFDKPI
FTQLLTGPTELWEGQLARYECRVVPVGDPNLRFEWYVNGRELKMGSRFHMNHDFGYVTLD
ILKVITEDSGVYTCRAINKAGEAVSSISLKVKARSAIDADSLQPDAWQKIQLKEAEMNKV
PEMFVDTTPQQAPVFTKHLESYDKLVEGQHVYLEAQVEPRADPNLRVEWFKNGVSLQTGT
RLRSTFDFGLVTLSINGLRADDSAIYTCKATNLLGEAVSTCSLKIVDRHWLLGDTLHPDA
LPKIDALEQPHVTTTDQPEPTYEEPVFITHLNNVECLEGDNVHFECNVEPSKDPTMKIEW
FINGKPLPTGARFKSTYDFGYVALDINHAYEEDSGVVIVKATNSKGSAQTSGTLKCTSKQ
NIYLQTQHPQGEAGLEKVKEAEDAYLSKMRRPDAGPEQEYPKPIWTVPLQPEFKLGESEP
LHLEGQVEPKDDPNLKIEWYFNGKALEHGSRFKMTSDFGFVTLDLTDVYERDSGIYTCKA
YNKAGEAFTSTTIYCSTKENIIERSQHPKGKEGLEAIQDLEESLKRAPGAAPESEEGHPP
VFTSQFENLTNLSEGEIAHFEASLTPTGDQTMVVEWFYNGKALEASHRTRTVYAFGMVVL
EVLGTKIEDSGTYSCRATNKWGQAEISVQLECVDKSKGQKPKFTTHIQSLEGLKDGQSAH
FECTLIPVGDPHMKVEWFHNGQPLRHSSRFKMVSDFGFVVMDIAGVMAHDTGEYVCKASN
KFGEDYTKATLKCFGKSGVYLDSLQPDSLARIRELESFGGEQPTTPTTPVAEPPKFITQI
VDITKLVEGQSAHFEARLTPVTDPDLKVEWYYNGKKLPHGHRYRTFHDFGIVILDILYCY
EENSGVYECRAFNKYGEDSTKATLKCYSKSSLILESQLPKGMEGGLEKIQTLEDSMIRTK
DEKVVEERGKAPMFTVPLSNIDGLREGESAHFEARLTPTDDPKLKVEWFWNGKPLRTGSR
FRTFCDFGFVILEISPIYPEDSGEYSCRATNEYGEAVTTCTMKCTGKRSIILESQLPKGM
ESTIDKIAELEGLGAVPGEVTPDDDTGKPPEFITTPSDLTLAENALAHFECRLTPIHDSS
MRVEWFHNGKALLAGSRIKTIHDFGFVILEVANCYQRDSGLYTCKATNRHGEATVSCKLQ
VRGRQGIILEPQLPTNFKTGTESIQKLEEALYKKDEILAEEETPNPPKFTVELKDIEVEE
GASSHFDCRVEPVGDPTMRIDWFHNGRSFATGSRVHQINDFGFISLDMSYTYARDSGEYV
CRATNKWGSATTKATITCKSKKTIDFDSQLPSGMSGEKLKELERGPISEPPAEEPPRQPP
KFITQIQSATVDESEPVRFECRVEPKDDPNLRIEWYRNGKLIPAGHRYRTTYDMGFVSMD
ILYVYPEDSGEYVCKAINDLGEDTTRASVSCKKLPSIILQNQVPKGMKKSEALMQMEATI
KKYTSEVHLTEDDLYDADKKQPPRFVTQIQDQTDLVEMNTTKFECQLAPVGDPNMKVEWF
FNGRPLPHKNRFTPIYDFGYVAMNFGWVYPEDSGEYLCRATNLYGMDETRAVIQTTGKPG
IIYESQLPKGMKSIEKIREMEAAWQIVPEEEGEEEKVRAPPTFVSKPEPVTVEEGDCSRF
CCRVTGHPRPRVMWIINGHTVVNGSRYKLTYDGMYHLDIPKTRQYDHGKVEVIARSSVGE
ARTETTLTVKPRSDDYRGVLKNSPRPWYDYELTQYQAERQNTELEKVFDERHHNISQGIE
IATEHLGQKVFKEPEAEWQKTVKTKKNEDYYNKLMNLEEEQVLKESRLREASHQFAIPGE
KVVAQSVAKGMAQQYEETLEGKEEKREDRSQETTQTQQKFVRKPFTTEVDIDVERTKAKH
PPEPSESTVHGREVHVAKQKQTQKEHKGDVEITRKITATETTEVEHKAKTQERVVQGPMK
PATPPVFTKKIQPCRAFEQEQARFEVEFDGDPLPTIKWYREDFPIQNSPDLQIYTFSTKS
VLIVRQVFMEDSGVFSVIAENRAGKAKCSANLVVEERRRQPGRGGVIPPSFLSTIQNTSV
TTGQLARFDAKVTGTKPLDVYWLKNGKKVTADIRYKTLEEDNTYTLLILETVPEDSGKYE
CVALNSAGEARCDAECVVRGPQSPTKTAKPTTPGVEKAPAVSEPLRDQTIKEGTSVAFAC
RITGKPVPTVQWKKGDKVIKPSKYFQMQKEGDLCTLRISEAFPEDEGVYKCIAKNPAGDV
TTSANLRVLAPDAADVLPKVTPLKDQVVVEGQPAQFKTQVTPAKPKPNIQWYREGALIPQ
SPDFQMIHEGNNAVLLIATTYEEDTGTFTCRATTSAGTVETSAKLIVKKRKGAYYEVPAE
TGPGAKTGVKPSVGLGTGGKDIVLEPLTLDENGLPLEIPLQPGDESLPWRKGQIRHRPRL
GDTTPWRKAKPKSRDTSLDKLQATEGQVKPWTEEAITLKKTPQVPRDIPKEKLEDVELKP
AKIERKEIRRPSLEAVDLKPVTKDVKEMKIEEERKLKRREATGEIYVEEEDTRFLKTTKK
VDETVEERKKEGPKPWTEEKVTLKKAKVERKEIPRETLESVELKPSQIEKNLIEKPSLEK
VDLKRFTTEKVTDVSKTEYLEQEDTSMLDVSRTEEVKKMKKEKIEEKVEQAKPWTEEKVT
LKKSKPIRKEIEKETVETVELKPSKVSKAPIQKPSLEQVDLKPVPTVVSEKITEKTEKTE
YLEQEDTALLDVSKTEEIKKIRKDKIEEKLEQPKPWTEEKVTLKKSTPVRKEVEKETIET
VELKPSKITKTPVRKPSLEEVDLKAVRKETTEKIVKKDVVQKADYVEQEDTTLLDITKDT
RVKKTRKESISTEKVEQAKPWTEEKITLKRAKPEKKEIPTEQVEKVELKPSRPEKPEIGK
PSLDQVDLKPVPQKVAPTTKKPEEKDIFVEKDDTTLLQVTKDVRVDEKLKKKPEEVETKP
WTQEKITLKKTKVEQKEIRRESIEEVTLKPTKTEKKEVKRETLEKVDLQQVTDKTKFVEE
EDTKLLKIDKDEKVEEERKEQTATWRRGKKPKEKTPYQEEEDKTILDVRKDVEEQQKEVP
VPWARGKKKPKEKVPYHEEEDTTLLDVEKTEKKTEKQAKEEVPVPWLRGKKPKEEKPELA
PERVQPEQKPEEEKLETTQVPWLRDKKVQRKIPERKEEPVEDIKSVALKPVRRERVPEEK
EKPEEVTLKPVKRIPREEEEKEEVQLKPIPKPKPEEKPREEVKLKPFEKPKPEVPEQEKV
QLKPFKREKPEDEKEKLVAQKVPEKPEEEQPTEVDQVTWRRKPKPKKTVVPEEKPEKALV
PQKVEEKPEEEQPKEVEQVSWRRKPKPKTTIVPEEKPQETLVPQKVEEKPEEEQPKEVEQ
VSWRRKPKPKSTIIPEEKPVEKVEEKVTEKVTEEQKILEVLKREEKEIEDWKALALKPVK
RGKKPEEREDKEEIMLKPVKRLPKEEETEEEIKLKPVEKPEKKVEMKKPLKTEMVGPTAP
EEEKPAEVSKLPWQRGKKKPAEQEETEVTIEEKKVVEEEQKDISEVSWRKPKKDKVVKEV
QKEVEVEDFSAVVLKPTRKEKKTEEKLEKEEVTLKPIQKAPKEKEKPEEVTLKPVKLEKP
ETIENGEVEKTELPWRRGKKPAKKILPQEEIKPEETPKPEERAPETIEQVKEQIILKPKE
KRKPEEEEKSEVKLKPVKRLEKPEEKPEEVTLKPVKRLPKEEEEKEEVKLKPIKKEKPEE
EKPEIKLKPIKRWEKPEEEKPEEVTLKPVKRLPTEEEKKEDVTLKPIQKEKPEEKPEEVK
LKPTKRWGKPEEEKPEEVTLKPVKRLPTEEEKKEDVTLKPIQKEKPEEKPEEVKLKPSKR
WGKPEEEKPEEVTLKPVKRLPKEEEEKEEVKLKPIKKEKPEEEKPEVKLKPIKRLEKPEE
EKPEEVTLKPVKRLPKEEEEKEEVKLKPIKKEKPEEEKPEVKLKPIKRLEKPEEEKPEEV
TLKPVKRLPKEEEGKEEVKLKPIEKEKPEEEKPEVKLKPIKRWEKPEEEKPEEVTLKPVK
RLPTEEEKKEEVTLKPIPKEKPEEKPEEVKLKPTKRWGKPEEEKPEEVTLKPVKRLPKEE
EEKEEVKLKPIKKEKPEEEKPEVKLKPIKRLEKPEEEKPEEVTLKPIKKEKPEEEKPEEV
KLKPVKRLPKEEEKKEEVTLKPITKDKPEEEKPEVKLKPVKRLEKPEEEKPEEVVLKPMK
RLPKEDEEKEEIKLKPIKKEMPEEKPEEVKLKPVKRLEKPEEEKPEEVKLKPVKRLPQEE
EKKEEVTLKPVERKKPEEEEKPEVKLKPVRRIEKPEEEKPEEVTLKPVPKPVPEKAEEKP
EEEETQETSIWPWRRGKKTKKIVDFREEVTVVPIDQERVVSEVKVDETTIVEQKVEAEQI
IQKEVTEIKEEKPEAPAPWRRSKKVVEEKIEVEEIKPEMVKEEEKVVEEVTEVSEVSWRK
KRKPKKPEDEKEIVELKPVERHEEIIESVEEVVLKPVKKEIVPEEVKEEKVHLKPVPKKP
EEQEVPEQITLKPVKKVKPEEKPKEEVPELKPVKVEKPEVPEEKEEKEVAVLEMPWRKPR
RKPEEVPAPVKVEKEEVETVVQDVRVTTKGVKVEKAPEEIVEVEQKVEEEVQVEERKRKR
KQRTQVDISITDKDKKIAPRFIQKLQPVIAQPETTARFTCTVFGNPFPEIAWYRNEQELH
ASEKYIITIYETTAVLEITKVKEEDAGMYSCRASNPAGVATSTVNLVIFEKEEEGVAPHF
ATPIKPLMVEEHKPALLECVVTGTPMPEVKWYRREQELQPQKGKEITFNPETGEAKLHIL
EPTEEDETIYRVQAVNKFGRAECRANLVIRSVVKVSKPEVLRAPKITRPLPALTAVRGKP
LTLSADFESTPKPEVKWFRNGIEVTPSDKRVINIYENTAELHIPEVTKKDGGKYEVRVEN
PAGEARTSGTVTVKEHEDKTDEVKAPRFIEPLQPQIVAEGEVVIMETRVDSYPAASFQWF
HETTPLESTPQVRIVTQENRSIVMIKEVKPEYAGTYTCRAENVAGSVTCTATINLLDTPW
EETVELVSPTFARRLSPVRVMDGESANLTCVVHGKPTPRVEWYHDNKPIKEGKEITIIQD
TEGVCSLAITEVFPEDAGEYTCRAVNPVGEAVCTSSLIVEGNSRFLIKLMETPLFDTDTE
ESAPEIIKKLPQLIPTKDGELTRLEVKVKGKPKPEGKWYKQGVEIVSSQEFQIEEFEDGT
SVLTIAETYPDDTGEIVFEAHNPLGVSTTTTYLSVEGILGTKEYRKPEWVIQMEEMQEAL
RATQSVPRFIQEITDVYAKEGETAIFECSYSGNPAPDVVWLKNDKMIMNTQNVKVRILDE
EKKTTLTIKHATEEDDGIYVCKATSEIGLAITKAKLRVTDVTGERTFSFDEDVEEQEIKP
EKKPEEEKPRKKKKPELKKAKETKEKIKTERVKVDKKELRKEKLVPKEQPEEKKIVDIEE
TQVLETTEVIEEKPTEVSKAKKVVPIQEPVMTEAIASMKKIDDQKPREMVPKPDERAKPV
MEEREGVVVISEVATDDVVQDFTVESVVDRAQITSETLQTVSVSEVRTEASVQEIRRVDT
KQRKAKKTVVTEEEIFEEKPREVVTEEKPKKKKKKVTIEEVVKRERENIAKEVEEIMEVL
HAKEFGPGEAPLRELATIGFLVRQGVSVNEINESLYRTDNFPALKTPEAQNALVQLVERE
GHGPLITQVLTEETTTDESVVAATVGFRAFMRMIELQHVTVEEVLTHFAPEDFRPRAWEV
TEATEVETEERVTERVDVVRKTEVHFMERRDERKAVRTQDIRDIKEYEDTRQAHTTLRER
KVKPKEQERKEDRDEGVQVVEIEEVEETEKKKRKDVEEVEEETETIIVETDSKGRLIQKK
KDRDDLEKRVDVEEEEEIIEKVRKELKPKRPQLGRDEIELEETEEFEITKDKSVPSIALN
VPSQRHQVIPLDRTVEQAPGKPELETAKLTLDTITPLTEHLVPVQEKEIDDITLIKPVER
KASLSISPVEPYSTTETTVQATTGEFADTFKPTTYEATPGVVSSESIVVSETLTNDADVS
SLTITKQELSRTADVSVTLQEATTVYETMVNQKEVPTEDFVSPLTAKAEDTFLPQVGLSV
YEVQEGLTEDKLEPMKTVPTKPRVNVTAVEPLVVEEVRAEDKPGKYYPELIVPTEVATET
VIPQRQRVTEEMHAPEKEGEYVPGRLPPSQKAQVGMSYGNETAIVEQNVVQESEGIFVSE
RKTDTFEATPNVTLLEGVSVSTVQTQDTEVHLTIEETKKAVADLNVVEITSAVTVETVPS
EKEKEYQPGDKPDARTAETSISSLEIGSIASTIIQESEGVYQPDQKPTKALAETSIRPEE
HVTVSEIQTADYPSDFKEELKYVQESGTVSVQLTEAKLIQETLAHDSETKMDEIVRPEER
VVETSYDAIRSVEVFQTTSVEKEAELKIFEMPESHRGKTVPTHPVVSLEIEMTQPEDNLG
EVKKDVPSTGVAKIEPIGLQETVVGETVVAEDVAPVQKDKVPQSMMAEVTMNEIESVHTT
MVVASEKEAEYTEVSEIKGAYASTEFTTQVAPVFEEVRTHSPTGEYVPEEKPASGVAQPS
HIPLESVTIAMQEIAEKEDLYKTDMKPTEKTAIVELTEPRPGPTVLEVIPHDRENIYSPD
AKPQDYTAQPLVSGHTVALKSETLVEQSTGDMSIDKPKSEKAIPQRDALEELIITETNIA
ETEKTREEDIKPITQSAELQIQSKTEKLTVTEVMSVQEEEKLDVEEIPKERTVTLGITGG
HEVAEMQETVLASNINILKEEKVKEEHAGQQQTGLEVVEQTEISISEKESPLQKDVKPDT
KNVEVTFEEGEGIVVGMTYPEDKEGIFTGEEKPKGVEATVDIITQGVASKFEVLTDTGLS
DLPDEKVQEAKPHTTILPIEAAIAEEVQTRETEAPFSEIKPSDKKANLEFVTGEGLIVSA
VTTQDKESILPEAVKPETKSASFDIPTHIVAQTSETTTTDNVGEFKHEEAVPATATADHI
PFRSVIASETAPVDLEKPMEDFVQPDKKNVDVTFEEEIGVTVTETIASDKEKEYFKKLEI
QGEQATPSFDAHKVAQLMEINPAAVSGDLTVPVPTTGAAKEERLPYESIVQTETIVSETE
KEFKDKPAITNKAEITINEIISATTTTEIPADKEGTLKIPEKPGEKQASVQFAGHIIAEK
TEITVDASVGELEKDKPVSASAVPSSVPLEALISSETQPTEAEGLFTEDQAPLKALADLS
LVEEQSIQVSAVVLEDKEDEYKSKELPEMKTAGKSLVSGHVVAETTMQVVDFSTGELVEE
KPTGAIAVPEHIPLIPLIESQTVVQESEDKFVPGQLPENKTAIVDLEEGRKIVTVSQVTP
ADKESLYVSEEQPSKHAASVGLDTTHGIAETTTVSVEDSVSEVRIEKPDTKKAMSSQEVH
QSVVVTQNIVQDQENIFEGKFKPTVQTVDVSIEEGKRVTTVTEVGVADKEEILKTIQEEK
TRSAVPAIVSGHEVAERSEIIPQQSTGEVDIVKPVTATAQVGQKPFETIETTEQVLAEKE
VDTIKELTMQKTSARVTVDENRFIAITEATTTQDVEAELSAMKKPHEEVAKPAMEGKEVA
EQMEVNLREGLGELPQAPRPTTFEAHPTQTTLESVDVRETVPQEHSATFEEKMKLDEHSA
KVSFVEGKSVTVSHVITQDKEDTMKIKKHEESTAEVTLTKVGMDVAQKAQVFVEQSTGSV
QPLEKHEVKAHPKQDALEPIIVEETPSAESEGIFDKYPKAVSSTAVPTFEEGHGVSITEV
TSAEAEAVFKEKKLDASQTASSTIITERNIIETTTIESQVNIPDKVEEAPIKPQVAVPEQ
DTFESVIVSENIVEESERTFEGVFKPQTQKADVDIQKVTSLQVSETVTEDKESIFDVVPK
REGVRATQDISLHETVVGSMVESMQSTQEIHEEKRASSQATMTQTTIETAVKMETTLGEV
EDTFEKEFKPETQKGKPQMEGLTTVTVTEVVSNEIEDVLPEVVAPKEQTAQPSLTGREAP
EVTQVVTAATTEEFEKITELKERQGKVEVEELSSVTVSEVISHETEDVLTSKIMPKDQKA
DFNILGREAAETTQVMTMTGTEDLTLKRPEEQKGKPKLDELTPLTVSHVVSGEAEEALPT
AEVPKETTAQPSLTGRDVAETTQVLTVASAEEMLAPKAPEEQKGKPQVEELAPLTVSQVV
SQEAEGELPTPEVPVEREAQPNLIGRDVAQTMEVLTMSNVDTLAEDKKPGEQKGVPGLEE
FVPLSVSQTISSEMEDVLPTAEVPTEKLAQPSLTGRDVAQTMEVLTMSNVDTLAEDTKPG
EQKGIPGLEEFVPLSVSQTISSEMEDVLPTAEVPTEKLAQPSLTGRDVAQTMEVLTMSNV
DTLAEDTKPGEQKGIPGLEEFVPLSVSQTISSEMEDVLPTAEAPTEKLAQPSLTGRDVAQ
TMEVLTMSNVDMLAEDTKPGEQKGVPGLEEFVPLSVSQTISSEMEDVLPSAEVPTEKLAQ
PSLTGRDVAQTMEVLTMSNVDTLAEDKKPGEQKGVPGLEEFVPLSVSQTISSEMEDVLPT
AEAPTEKLAQPSLTGHDVAETMQVLTMISAELLTTALAPEEQRGKPNVEELTSITVSQTV
SHETEETLDSPAAPSTVTAQPALSGREVAETSQILTVTNVGELEKPVLPEEQRGKPLLDE
LTSITVSQVVSSELEDTLPSPEKPSEKIAEPQMTGREVAETSQVLTVTNVGELEKPVLPE
EQKGKPLLDELTSITVSQVVSSELEDTLPSPEKPSKKTAEPQMIGREVAETSQVLTVTNV
GELEKPVLPEEQKGKPLLDELTSITVSQVVSSELEDTLPSPEKPSEKTAQPQMIGREVAE
KTEILTVTNVGELQKPEQPEGQKGKPDVEEMSFITVSEVVSTEAETDLPAPEAPKKRRAL
PQMDSIEVAETSEVLTMTSAEELPKPKAPEEQKGKPQLEELLSLSVSEIAFGEVEKGLPT
PDEPTKQTAIPSLMGIQVAQKTQVVPSAATSELEETAKPDTKQIIPEQIPFEGIEQLQPV
TQESEGTFVVEKTAKSATAEVSFRVSESVEVTQVTTTEQESKEVIKGVAKEVSAQPDVIK
HEVALKTEVQPEDAAAEFKVTKPESKTAKGVEEIQQGVIVTEHLTAGEIESELLESVIPF
AKLASVSIEAEHLDHVVETTEVPAQQHHITITQHTTKHELPQQQSVESDTEVIEEYTTKF
RRGSTDDETAAVKTKKTIIRKKKPKTEAEKDNVVVIEEELEDVKSQIPSIPKKQFMPIEE
VTTIEDVEEIIPSRIDEAEEVVDKQDEKVEVEVVQVQDTDKTKKIKKKIIRKRGTAEEVT
EEVKIEEEEKKPERKIKKPVEEEVPEEEAKPLKPIETERVTPTVEQVEEQVTVTEETTKE
GKPKKTTRKKIITRKGKEQQVKEVVTIEEQGKAPVTSVTEGPVEEVVEEIVKRLPKPEYA
KPSEVEEVREQVTVTQEVTRWGKPKKVTKKKIIKRKGQKQQVTEVVTVEEEGKAPVTTVT
EGPVEEVVEELITPLVEEQGKAPVTTVTEGPVEEVVEEIIKPLPTPESVKPSEVEEVREQ
VTVTEVVTKEGKPRKVTKKKVIKRKGKEQQVTEVVTEEEEGKAPVTTVSEGPVEEVVEDV
IKPLPVPEFITPSEVKEVREQVTVTEEITKLGKPKKTTRKKITRRKGQEQQVTEVVTVEE
QGKVPVTTVTEGPVEEVVDETIKPLPAPEYAKPGEVEEVREQVTVTQEVTREGKPRKTVK
RKVIKRKGQEQKVTEIVTVQEDGKEPVTTVTEGPVEEIVEEAVKPEFMQPSEIEEVREQV
TVTEDVSREGKPKKTIKKKVIKRKGKEQQVTEVVTVEEQGKAPVTTVSEGPVEEVVDETI
KPLPAPEYATPGEVEEVREQVTVTQEISRFGKPKKTTKKKITKRRGSEQQVTEIVTVEEE
GKAPVTTVTEGPTEEVVEEVIKPLPILEKIKPTEVEEVREQVTVTEEVTREGKPRKVTKK
KVIKRKGKQQQVTEVVTIEEQGKAPVTTVTEGPTEEMVEEIIKPWPIPEYAKPSEVEEVR
EQVTVTEEVTKLGKPKKTTKKKIIKRKGTTQQVTEVVTVEEQGKAPVTTVTEGPVEEVVE
EFITPLPTLEKVKPTKVEEVREQVTVTEEVTKEGKPKKVTKKKVIKRKGNEQQVTEVTTV
EEQGKSPVTTVTEGPIEEVVEELVTPLPIPKRIKPSEVEEIREQVTVTEEVTREGKPKKV
TKKKVITRKGKVQQVSEVITVEEQGKAPVTTVTEGPTEEIVEEMIKALPAPEYAKPGEEE
EVQEQVTVTQEITKEGKPKKITKKKVIKRRGSEQKVTETVKVEEEGKAPVTTVTEGPVEE
VIEETIKPLPKPVRIEPTEVVEVREQVTVTEEVTKEGRPKKVTKKKVIKRKGKEQQVTEV
VTVEEKGKAPVTTVTEGPLEEVVEEVLKPLPLPEYAKPSEVEQIREQVTVTQEITREGKP
KKITRKKVIKRKGRKQQVTEVVTVEEQGKRPVTTVTEGPIEELVEEIVKPLPMIEYVKPT
EVEEIREQVTVTEEITKLGKPKKTTKKKIIKRKGKEQQVTEVVTVEEDGKAPVTTVTEGP
VEEVVEEFVKPFPTPEKLKPIAVEEVREQVTVTQEITREGKPKKVTKKKVIKRKGKEQQV
TEVVTVEEEGKRPVTTVTEGPVEEVLEETLKPLPAPEYAKPGDVEEVREQVTVTEEITKE
GKPKKTIKKKIIKRKGKEQQVTEEVTVEEKGKRPVKTVTEGPVEEIVEETIKPLPAPEFV
TPSEVEEVREQVTVTEEITREGKPKKTTRKKIIKRKGKKQQVTEEVTVEEQGKRPVTTVT
EGPVEEVVEEILKPLIAPEYAKPGDVEEVREQVTVTEEITKEGKPKKTTKKKIIKRKGKE
QQVTEEVTVEEKGKRPVKTVTEGPVEEIVEETIKPLPAPEFVTPSEVEEVREQVTVTEEI
TREGKPKKTTKKKIIKRKGKKQQVTEEVTVEEQGKRPVTTVTEGPVEEVVEEILKPLIAP
EYAKPGEVEEVREQVTVTEEITKEGKPKKTTKKKIIKRKGKEQQVTEEVTVEEKGKRPVK
TVTEGPVEEIVEETIKPLPAPEFVTPSEVEEVREQVTVTEEITREGKPKKTTRKKIIKRK
GKKQQVTEEVTVEEQGKRPVTTVTEGPVEEVVEEILKPLIALEYAKPGEVEEVREQVTVT
EEITKEGKPKKTTKKKIIKRKGKEQQVTEEVTVEEKGKRPVKTVTEGPVEEIVEETIKPL
PAPEFVTPSEVEEVREQVTVTEEITREGKPKKTTRKKIIKRKGKKQQVTEEVTVEEQGKR
PVTTVTEGPVEEVVEEILKPLIALEYAKPGEVEEVREQVTVTEEITKEGKPKKTTKKKII
KRKGKEQQVTEEVTVEEKGKRPVKTVTEGPVEEIVEETIKPLPAPEFVTPSEVEEVREQV
TVTEEITREGKPKKTTRKKIIKRKGKKQQVTEEVTVEEQGKRPVTTVTEGPVEEVVEEIL
KPLIAPEYAKPGEVEEVREQVTVTEEITTEGKPKKTTKKKIIKRKGKKQQVTEEVTVEEP
GKRPVKTVTEGPVEEIVEEIIKPLPALEYVEPSEVEGVREEVTVTEEITKEGKPKKTIKK
KIIRRKGKEQQVTEEVTVEEQGKRPVKTITEGPVEEVVEEILKPLIPSEYAKPGEVEEVR
EQVTVTEEVTKEGKPKKVTKKKVTKRKGKEQQVTEVVTIEEHGKAPVTTITEGPTEELVE
EVIKPLPETSPEAIKPSEVEEIREQVTVTEEITREGKPKKITKKKVIKRKGRDQQVSEIV
TVEEQGKAPVTTITEAPIEEILEETVKALPTPEYAKPGDEEEVREQVTVTQEVTKEGKPK
KTTKKKVIKRKGDQQQVTEVVTVEEQDKVPVTTVTEGPVEEIIEEALQPLPAPEVIGPSE
GEEIRAQVTITEEVVKEGKPKKVTKVKVIKRKGREQQVSETVTVEEEGKAPVTTVTEGPK
EEIVEETIKTLPVPEYAKPDEVEEVREQVTVTQEVSKEGKPKKVTKKKVIKRKGPEQKVT
ETVTVEEEGKAPVTTVTEGPVEEVVEEMVQALPTPIRRKPSEVEEVRAQVTVTEEITKEG
KPKKVTKKKIIKRKEKEQQVSEIVTVEELGKAPVTTVTEGPTEEILEETLKALPAPKYAK
PSEVEEVREQVTVTQETTEEGKPKKTTKKKVVKRKGKQQQVTEVVTVEEPGKTPVTSVTE
GPVEEIVEDIVKPLVMPEFVKPTEVEEVREQVTVTEEVTKEGKPKKITKKKVVKRKGKEQ
QVSEIMTVEEAGKAPVTTVTEGPTEEILEETLKALPTPKYGKPDEVEEVREQVTVTQETT
DEGKPKKVTKKKVVKRKGKQQQVTEAVTVEEQDKAPVTTVTESPMEEIVEESVKTLPVPK
PIEPKEDETPEEEVVTKEGKPKKIVKKKIPKKVPGKEEEKPEVPELQEVPVEEAKKPKPK
LKRMRSTVMKFESTKLEVHEISTDKPLFAQIKLRKTPTVKRPVEKKEKLHRVLLRSRIIP
VAWPSPIKYLKIEELEPNEVQNGILSRNVEEAATLPKPKKKKVKRLEKEIAKLEKLDQEF
EELKKELPLEKLEEPVIEKPEKKVKKKKKPVEEVKEGVKLQLMKITIKEQKPIKPKIDEP
ATPLFAQIKLRKAPIKPKKKGEKEEKFPKILLRSRIVEHEWPPSIKYPVITVLEPNYVQT
GILSRTMEEALKIKKIKHKKMKLPEKEITELEKLDQEFEELKKVPLEKVEEMAPYERKSK
PKEPEEEKPKKLKIGKGKIRPAEEQEPETVKLKKIPEKVPSVPEEEAKVPKKKDEVDKPK
KEKEEKEYPELKPFEPYDIDRPEVELEEMEKPEYPEPEKEEPDKIPGKRIKKKPKKPAQE
TEAIPIVPGVPKPKEPEEEEEIKRRIPEREAPPEEPEKIKLKPWKKPKEEKEEEKKPEDY
LKFVPNDDDIVEIVEIVTVVEEIPEKKPRKIKKKKTTTKRGEKPTVVEETVIEEEGELPI
VTVDEIVVEKPVEEIREEIVTSEIVTEEGTKRTVRKRRVSRKREGKERVIEEVTVEEEGK
EPLTATTEPYEDTTPEIHEKPKHKRPKKPKADEKVTEDVTEEVVQKVEEVKKKVTKKRKP
ITAEDEVTEEVVEEIITEIPEEHEARPLVEEEETVTITEQEVRKAPKKKKKEVVIKEEEE
IFETIETPTQKIIRKKRRPMKKGEGEEIVVEEIIEKPRQETIEMEEQQIVEIVETPTKKV
VKKKKEIVKDDGVPEEIVEEIIIEKPQKEKAKPIVEEEKETVKVTKVESKKAPKKPEEEI
VEEEEVIETIETPTTKIIRKKPKDKKGKIVEEVIQKTIEEAQAMEEQEIVEIVETPTKKI
IKKRKASIKEGKAPEEEVEEIVIEKPIKEKAKKAIVPKEGVEVTEIITETSVEKLPDEKV
KPEEAKEKPSEITKEKVEVTQVEVKKAPKKKKKPVTAIEAEEKEEVVEEIKPELPKTEKA
EPIVTEEEGVEVTEVVTEVTTEKLPEEVKPKKKKVTEVKEKEEKVTTKKVKVKEAPKEGV
PEEEEQPEEKVEELITEKPKKIKAKKEVTPQDGVITTEVVPTTAEEELQIEKPEEDKAVI
TEEKEERAKVEEKKVTVKKAMKKKLTPKETEEEQVEEIVEEITPEEPKKRKAKKTILPKE
ELQTTEVVPEVATEEIKEKKPKEEKAVPKEEEKVEEEARVTEVSVKKVPKKKKKEDIVTN
GEIIEDKPKVEEIPEEKLEVKEEVEKEKPEEEKPKAKKPKVEKPLEEKPTEEKPLEEKPK
EEKPVEEKPKEEKPIEEKPKEEKPVEEKPKEKPKKKKPVEKKPAVTEEEQPEEKVEEIVE
EKPKKVKAEKEIIPKETVETTEVIPEAVTEELPTKKPKERKVVPTEEKPEEKIKITEVPV
EEKKEEVPEEIPTEEVPEKPKETKVVKKKKKKVAKKDEIEEWVEPEYERPVLEPMPEKIQ
WEPKKKKEKKPLPESLQKLVPQKIERKEIKPTKLKYSEPTETVQFASIKLKKVSVPKKKS
VGEVKIPKIMLRSRMTFIDDYPPELQIPEITELEENPVQAGILSRNTEEALEVLKRKVKK
VKLPKKEITELEKLDLEFEELKKVPLEKAEEMAPYERKPKKPAEKPKEPQKVVVGKGKVP
EEEKVEPEKVKLKKIPEKKPEEVEEPLKKPVKKEPEKEVKPEKKEKPKMKLEHDEFKPLD
FERPELEKYEPEEFPKPEEPAPEPVPKPYEREEKKKPDQEIEQVPIIKGVPKPPEKEEEP
EVKFRIPQKEKPEEEPETITLKPWKKEKPEDEGVKELPKKEEEEAPKVPKEETEEVTVKR
KAKPKKPKEKAPKEEEVTLKKPEEKKPDEVPEVIEEITLKKEPEKPVEEAPAEVTIKKPV
IEEKEVEEEEITTEVTMKKKPKKPEEIVEEAVVKKPKKKKPVKEEEAVEITIKKEEEKEE
VEEVKEEVVIKKKPEEKPAPEEVTEEVTLKKPEEKPEEVVEEIKKPKKKKAVKEEAAEEI
TIKKPVVEEKKEEEVPEQVTLKKKKPKEKPVPEEVKEEITLKKPVPEEEEKVPEEVTEQI
EIKKPVEKKPVEEIAADEVTIKKPVPVEEEKEEIVEKITLKKKKPKEKPVEEVTEEVTLK
PVPKEKEKAPEEVTEKVEVKKPKKKKPVEEEVAEEITIKKPVPVEEVEEEIVEEITLKKK
KPKEKPVPEEVTEEVTLKPVPPKVEEKAPEEVTEKVEVKKPKKKKPVEEEVAEEITIKKP
VPVEEVEEEIVEEITLKKKKPKEKPVPEEVTEEVTLKPIPPKEEEKAPEEVTEKVEVKKP
KKKKPVTEEAADEVTIKKPVPVEKEEEEIIEEVTLKKKKPEEKHVPEEVTEEVTLKPVPK
EEEKAPEEVTEKVEVKKPKKKKPVEEEVAEEITIKKPVPIEKEEEEIVEEITLKKKKPKE
KPVPEEVSEEVTLKKPVPKEKEKAPEEVTEKVEVKKPKKKKPVEEEAADEITIKKVVVEE
KPEEEAPEEVTLKPKKKKSIPKEEAETEVTLTKPKPVEEEKAPEEITEKVEVKKPKKKKP
VVEEEAAEITVKKPVPVEEEAPEEFTIKKKKKPERKPSVTEEVEETAVTIKKARAPEKPT
EEEEVTTEVQLKKKKPVPKVTEEAAEELTIKKVEEIEQPEEEEIHEFTFKRKPPKLPPKP
IEEIYEDVTLRKLRPKKKKPDIKEVTEVENVTFRPRSTKTKEDVEQEFKISLNTYEEEDI
SMSGKVRLKPKKKPMTYSEEAGEETIRIMQEVEDDSGPIIEEIIESDEEGGDEYMIEELE
TDEMRLPLKRRRKKERKPYKVEDVEEGDVRLKLKHERKYSIEEADETLALKLKGRRRVST
YEEEEASLSITREEDISEGEEIEYVIRDGDTMFSICSYVAETDEAINLVEGERVYIIDHS
NQDWWFVKKHLTEEKGWVPAQYLLNEVHYTLYLQRKLHEKIDKLPVFEKPVPGEETSAPK
FIEKLQPIHTPDGYTVQFECQVEGLPRPQITWFRQTAIIKPSPDFQMYYDDDNVATLIIR
EVFPEDAGTFTCVAKNTAGFASSTTELTVEAPLSDHGSDVTGPSRKSLSRESSLADILEG
IPPTFSRKPKAKYVNEGEDVILECRLVAVPEPEITWYYKDTQITNKENIAVATESDMHMY
CSVIKITKVQKKQEGKYTIVARNREGEATIEIPMKVKTGKSEPPEILEPLQSYVVREGET
VVLSAQIVGHPAPKVTWYKNGKPLKTLTPKQDGHVNTLTLIQPKVTDSGEYSVVATNDLG
TAETKATLTVEKIPSGAPEPPLFTERFQGLTVPEKGTFKLVAKVTGNPVPEVTWLRNNKP
LEKSPNITESYDGENIALEIRNADSEVDSGDYKCIASNPVGKTSHGAKVTVDVEKVTFTK
TLPKEVVIDEFKTLELTCETSHTVSTKWWHNDKEISGMDHREIVQDGHVHKLIIKRTSSK
DEGTYECTVKNQSTSSKVTVKATKPEFVKELQDCEVKEREIAILEVEITSETADVKWFKD
GEPLGPGKEKLEFVKDGTVRKLLIRSTSVHDEGEYTCSLADQKCTAEVTVIELPPEIISK
MQDVTIARGERATFDIELTKGDAKVRWFKDGQEVQFSEHVRLSIDGKKQKLKIYDTEPED
AGVYSCEVGKQKSSAKLTVEEPGVDFITKLPDVTLVPMNADAVFIIELSRNVPVTWLRKT
EVIKESPKYTIIDEGTVKKLIVKKCTTEDISEYTAVVTNVKTSSKLRVEVVETAPKISPE
TPKKYKVRKGEDVEIIVKFTAAPKPDDEWTVNGRVVTKSKRVVPSIDEESAVLNIYQIEE
DDVGDYTLKLVNNVGEASIEINVVIVQVPSAPGAPEPLEITNDSVTLHWKKPDSDGNSPI
VEYILEQQEKTETTWTKITETITETTHNVTKLTTNREYVFRVTAVNEAGPGETSPTSPTI
KISKPSAAEPPVVLEPLKSVIVGLDETVTLSCVIRGTPLPEITWLRNGETFEDSSITYEN
RVAKYTITKTTETSSATFTVKAKNNVGTAETTCELKVQEAPKISYDETLASQTLPVNEQW
KIEIRTSGFPKPEVTWSKNNRSIVDKRVSIRTEENTSTISISSLIREDTATYTAKAANQT
GSASVDLHLKVIDKPSKPEGPVVFKEIRQDRVTIEWKPPIDDGGIELEKYTIEKWEPGKA
WTKVVDIDKEVESFCVHKLQQNAEYKFRIIAKNTVGPSEPLESETVKMRTSFEPPGPPRG
PLEVSGMTKTSFTINWQPPENDGGTPITEYIIEMKEESKKAWQKIGSTKHETTHFSVSDL
KTDVPYNFRITAKNSAGTGPPYVAEEPISPGRRIKITKLDERTMYALLGIFPPTAIIISK
TPPSSPQHVQVTHVTSKSATLSWSPPVSNGGTELTGYVIEKRPLIGKGARWTKVATLEPT
QLQYCIENLKESEFIFRVFAENNMGLSLPTNSEPVTLMTHATVPSPPTAPLEIRQIAANT
VVISWGRPETDGGAPLEAYKIAIKDAKKTMWMEVGRVNADVQKLNIRDLQENHMYLIRIY
ARNEVGFSEPLESDEPVKIVPVSELAVVEPIAEVTEKGETASVSFSTENTSSWLRDHNMD
ADIHTYARARLLRQDEYFFRIWHYAKKLFKE
NT seq 58956 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgacaaccgcctcagcagcagcagcaacagcagcagcaacagactagcatgcaa
cagcaacagcaacagcaaacggtcatgcagcaacagcagcaatacactcaacagaggacc
gagcgacaggtcactcgacagcagatcaccagtcagcagagagttcaaggggagattgtg
atgcagacaacgcccacggtaccaacatttaccggcagacccggtgatccatcgccgccg
gtcttcgaacagatcttcaagaacgccagattcgcgcagggtgggaacgcgattttcgag
ggtcgcgtccgaggtaacccgaaaccgaacgtgtcctggacgcacaagggtgcaccgttg
ttggaatcatggaaatttcgaatgtcctacgacgacaagaccggcgcagtcacgcttcag
ataaatcaaatcggccccggagacgagggggaatacacgtgcagtgctaaaaatcagtat
ggcgaagcgatctgctccgtttacatccaaccagagggattcgggccaccaccgcaacaa
caattgggaggtttcaaaaaggaatatgcgcagtcttttcagtccactgagcagaagagc
caaacaggaactcaaagtttccaacaacgtagttatcaacaaacaatcgataaacgaagt
tacgttaacggaacatcgaccagcatcgaagacttcaaggtggacaccttcgaatacaga
ctgttgcgcgaaaccgaatatcgagagtcgattacgcgccgcttcgtgggcgaatccgac
gcgcagatttcgacgacggtagaccgtagcctgggaccggtcgcacctccgcaaatcaca
cagaaaccgagaagctcgaagctcgtcgagggatccgatgccgttttcactgcgaagatc
tcgggtaacccaaaaccaagattgacttggttcaaaaacggtcagaggatccgcgattct
caacgcgtggagacgagctactcgaatcagcaagccaccctgaaaatccgaatggctttg
ccggaggacagcggaaattataccctactctctgagaaccctcaaggctgcaccgtcagc
tccgcgtatttggcgatcgagtctaccgatcaggtagatcaagcttatcagactcagcgg
gagacggtcaaaccgcaacaagtagaaacaactggcgatgaatctggaaaggttctacca
ccgaatttcgttcgcacatgcaccgaccgcgatgccaccgaaggaaaaatgactaggttt
gattgtcgcgtgacgggtcgcccgtacccagaggtgacgtggtacataaacggacagcaa
gtggccaacgacctgacccacaagatcctcgtgaacgaatccgggaacaactcgttgatg
atcacgaacgtgagccgcagcgatgctggcgtggtgacctgcgttgccaggaacaaggct
ggagagacatccttccagtgtaatttgaacgtgatcgaaaaggaacaagtgctcgcgccc
aaattcgtcgaacgattcaccacagctaccgtcaaggagggtgaaccagttgttttcatg
gcacgcgctgttggtactcccgtaccccgtatcagctggcagaaggatggagtgccgtta
acacccggaccggacgttcgcatatcgacggacggaagcggagcttcgagtttggatata
ccctacgcgaaactgtcggatgcagcctggtaccagtgcacggcgcagaacgtggctggc
tcgacggcaaccagagcacggctattcgtggaaacaccgaagggagtagcccccgaacca
agacgcctgaatttaccccgaccgacgaaaatcatcgaaccagaaccagcgcctggcccc
gaagtgatttacttgagacatgtggaacgtgccaagccgtatctgcctccaccggaggaa
gacagagtctatccaccgccacgtttcatcatacctttgagggacgtccatcagatcgag
ggtggacgtattcacttcgaggccagaatcgaaccggtgggcgatcccaccatgagggta
gagtggtacatcaatggaagagctctcgaagcaagttcccgggcgacttccattttccga
tttggcttcatatcgctcgatttgcttagcattgttcttcaagatagcggcgaatattta
tgccgcgtcgtaagttcaaccggagtcgccgaatctcgagctaccctcagcgtgacgcct
cgcgcaacaatcgaacaggctagtcagcaccccgacagcctccagtacattcaacagctc
gaggattacagcaaatatcaaaggcaggagagtgtggaggatatctcttcacagcggccg
gccttcatccgaccgctccaggatctaggagaactgcaggagggacgtaacgcccatttc
gaggcgcaactgacccctgtgagtgaccccacgatgaaagtggagtggttcaaggatggc
aggccgatcacagctagctcaagaatcacaaccatcttcaacttcggatacgtctcgctc
aatatattgcacctacgagctgaagatgcgggttcttacactgttagagctgtgaaccgc
ttgggagaggctatcagctccgcgtctctccgtgtctttgcacgcacaagcgttacttca
gatttaggaatccccgagcaacagaggtacatcgaggctgccgaggagttggaagcttat
caacaggcgctgcacctgagatacgtacaggagcaacctgaaccgaccagcccaccggaa
tttaaatcccctatcaaggatcagaacagcatacgagaaggcggatatgctcatttcgaa
gctcgtttagagccagtcggtgattccgaactgagagttgaatggctcaaggacggacgc
cctgtagaagcaagttcacggatcacgacattcttcaacttcggctatgtggcattgacc
ataaaatacgtaacgatccacgacgtcggcatatacacctgccgcgcatacaaccgcgcg
ggcgaggcccatacaacggctcaactgagcgtgattagcaaaaacgacgtcatttacgac
agtcaacatcccactggacttcagaagattcaaactctggaagattcgagcagatactcg
cgccaagtagaggaagaaacgcgagtaattcaggctccacgatttttaggaaacctaaag
ggtaccaataagatcgtcgaaggtcagcgtgcccacttcgaagctcgcgtcgaaccacag
agcgatctgaccatgaccatcgaatggtaccataatgggaaacccatcactgctgccaat
aggattcaaacttatcacgactttggatatgtggctatagacattcttcaggtcagatct
gaagacgctgggacttacactgtggttgctagaaatgctcttggacaagctcaactgtca
gccaccatggttatagaaacacgttcgggcgtggacaccagcagcatgcaccgcgctacg
tacgagaaaacacaacgtttggaagaatcaaagtttgttgagcctcaatatcacatcgag
gaaatttcaaaatcaaagccgatcttcgtacaaccattgagcgatccaaaaccagtgagc
gaaggcaagaacatccatttggagtgccgtttggaaccgatgggcgatccaacgatgaga
gtcgagtggttccaaaacggtcgaccggtcaccgtcggctccagattcagaacttactac
gatttcggtttcgtcgcattggatattgttcactcgacggttatggactctggtgaatac
actgtgagagccactaatcaccttggcactgctcatacttcagcctgtgttcgagtcatt
ggcaaatctgatatcgtcacggaaactcagcacgagcagtcacttgagcagattcaaatg
ctcgaggactcttcaagatatcgaagaacccaacaagaagaggtgacagtgatgcagccg
ccacaatttacccgacctttgcacaacgcagaaacggttgaactgacgaatgtccatctc
gaatgtcgccttcaaccagtcggcgatgccaccatgaaagtcgaatggttcgtcaatggt
agaccagtgaagactggccacagattcagaccatcctatgagttcgactacgtggcactc
gatatccttggtgtttatcctgacgactcgggcgtgtatacatgccaagcgagaaatcaa
ctgggtgaagctgtcacttcctgctcagtgcgagtacatgcaaagaaggatctgttgttg
gaatcacagcatcctgagggtttggaacggatacagtatctggaggatgcgtccagatat
aagagacgcgaattggtcgacgaagtagtcaacgttaaaccgagatttatcaccgcaccg
aagaaccaggagaatcttcgtgaaggacaatacgctcactttgaatgcaaattagaaccc
gtgactgactccaacctgaaggttgagtggtacaaaaacggccgtccagtcacaatagga
catcgattccgtccgatacacgacttcggttacgtcgctctggacgtcatcgacctaatc
gccgaggactctggaacctatacatgtcgcgccgtcaatcttgttggaagtgacgaagtg
tcttgcacattgacctgtcgttcgacagcgcaggtcttgaccgacacgcagaacgagctt
ggcctcgaacgcatccactatttggaagatcgtactaaataccaacgacgtgaagatata
gaagaaacaaccacacaggcaccgatcttcaccacctccttaaataatgtagagatcaag
gagggccagagagctcacttcgaatgcagattgatccccgtttccgatgcaacaatgaaa
gtcgaatggttccataataacaaacctgttaaagctggatctagatttgtcgaaacgaac
agctttggcttcgttgctttggatattatgtacgcctatcctgaagattctggcacttat
acctgtcgcgcgaagaatattattggagaggcgatcacctctgcaactgcggttgtgcat
tcgaaaaagtcgatttacacggaaactcagaatgaagagactcttcagcgaattcattat
ctggaagacacttctcgataccagcgtaagaccacgacggaggaaatagttactcaagct
ccagtcttcactatgcctatcaaggatctgagagtcgccgaaaatcaagcggctcacttc
gaagctcgtgtgatccccgtcggcgattccaagctgaaagttgagtggctgcgaaatgga
gtcccgatagcagcttcgaatcgcgtgacgacgatgcacgatttcggttacgtcgctctg
aatatgaaatacgtgaatcctgaggactctggcacgtacacttgccgcgcgaggaacgac
ttgggagaagcagtgacatcggcaacgctcttcgtccaatccaaggcggccctgcaattc
gagtcgcagcacgagggcgcgctgcagaaaatccaggcgctcgaggacaccagcaagtat
caacggcacgaggaggaggagattgtggtcacggagaaaccatcgtttaccgtccaattg
aacggacctacccatctggtcgagggtcaaagcgcacattatgagtgccgcatcgaaccc
tatccggacccgaccatgaaggtcgagtggttccacaatggcaagcctctgtcaactggc
cacaggtacagaaccacctgcgactttggattcgctgcgttggacgtgctcactgtatat
gccgaggactctggcacctatacctgccaggccaccaataggctgggatcggcgaagagc
tcgattaatcttgacgtgaagtctcgcgcctcgattattcgcgatacgcagcacgaaagc
gctctgaagaagattcaatatttggaggacgattcgcgctataaacgcgtgcaggacgac
gatttgatcatcgccgagaagccgaagttcggtcgcccgttgaagaacatagaacacctg
cccgaagggaagagcgctcatctggaagcgactctgacgcctgtgaacgatcccaccatg
gtggtcgaatggttcagggatggcagacctatccctcagggtcacaagttcaagaccacc
tacgattttggctacgttgccctcgatatcctctatgcctacccggaggactccggaact
tacatgtgcaaggccagaaacgctgtcggcgaggctgtaactacttgcgtcatcagcgtc
gactcgaaacaaggcctctacctcgatacgctagacgctcagcgtttgcagaagatccgc
gaattagaaaccgtagaggtgaaacaagaggttgaaaaggaggtcgtccaccagaagccc
gtattcttaacgccgttgaacaacctggatcatctaaaggaaggtgaacacgctcacttg
gaatgccgcgtcgaaccaatcaacgatccgaatttgaagatcgaatggttcgtaaatgga
aaggccgtgaaaacgggacatcggttccgcaaaactcatgacttcggttatgtggcactt
gatattctctacacttatgctgaagactcaggtacttacatgtgcaaggctaccaatttg
gctggcgaggctgtcaacacctgcaccatcaaagttggctctcgccgcagcattctctta
gatactcagcatcctgatggcctcgagaagattcgtgagctcgaggctcaaggtcgccca
gcacgtttagaagttgaagaaccaccagttacaccgcccagattcgttaccgaactcagg
ggtaccactgaagtatatgaagggcaaacagctcacttcgagtgtcaaatcgagcccctt
cacgacgccaacctacgtatcgagttcttccacaatggcaagccgttaccatcggcgtct
aggttccacgtgacgttcgacttcgggtacgtggctctggacatcggccacgcggtaccc
gaagacgcaggacaatattctgtgcgagcgatcaacgcacttggccaatgtgtctcctcg
atagaactaaaagttattcctcgagacaacatcattctcgactcgcaaagacccgaaggt
ctggacaagatccgcgagttggaatcgcagcaaccgtggaagagaccggaagtgccggaa
ccacagactaggcagaggccagtcttcactcaaccgttgcaaaacattgacgcgattccc
gagggacacaccgctcacttcgaatgcagattaatccctgtaggcgatcctacaatgaag
gtggaatggttcagaaacgagatcccgcttgaaaccagctcgagaatcacgaaagttcac
gacttcggatatgtatcgttggacattagtcatgtgagagaggaagacgagggtgtatac
atgtgtcgtgccaccaatgctcttggtgaagcagtcacgactgcttcgatgaagatacga
agcaaggctagtatccaaatggacacgcaacaccctgaagcgcaacgcaagattgcacag
cttgaggctgacaagccgcagcgtccggaagaaccggagaaaacgttcgacaaaccaatt
ttcacgcagctgttgactggtcccacggaactttgggaaggtcaactggcaagatacgag
tgcagggttgttcctgtcggtgatcctaatttgagattcgagtggtacgtgaatggacgc
gaacttaagatgggatctcggttccacatgaatcacgatttcggctacgtgactctggac
atcctaaaagtaatcaccgaggactccggtgtgtacacctgcagggcgatcaacaaagcc
ggcgaggcagtatcctcgatatccttgaaagtaaaagcgcgctcagccatcgacgccgac
agtctgcaaccagacgcatggcaaaagatccaattgaaggaagcagaaatgaacaaagta
ccagaaatgttcgtcgacacgacacctcaacaagctccagtcttcaccaagcatctcgaa
agttacgacaaactcgtggaaggtcaacacgtttatctggaagctcaagtagagccaaga
gcagacccgaacctgcgagtagaatggtttaaaaacggagtgtctctccaaacgggaacc
agattacgtagcacgttcgacttcggtctagtcactttatcgatcaacggcttgagagcc
gacgactcggcaatttacacttgcaaagctacgaaccttttaggagaagctgtgtccacc
tgcagcttgaagattgtcgatcgccactggttgctcggggatactcttcatccagacgct
ttgccgaaaatcgatgccctggagcagccccatgtgaccacgaccgaccaaccagagccc
acttacgaggaaccggtgttcatcactcacttgaacaacgtcgagtgtttggaaggtgac
aacgtacacttcgagtgcaacgtagaaccgtcgaaagacccgacgatgaagattgaatgg
ttcatcaacggaaaaccactgccaactggtgctagattcaaatccacctacgatttcggc
tacgtcgctctagacatcaatcacgcgtacgaagaagactcaggagtggttatcgtcaag
gctacgaactcgaagggatcggctcagacgtccggcactctgaaatgtaccagcaaacaa
aacatatacttgcaaacgcaacatcctcaaggagaggctggcttggagaaagtaaaggaa
gcggaagatgcttatttgtctaaaatgagaagaccagatgccgggccagaacaagaatat
ccaaaaccaatctggactgtacctctgcagccagagttcaaacttggcgagtccgagcct
cttcacttggaaggtcaagtggaacccaaggatgacccgaacttgaagatcgagtggtat
ttcaatggcaaagccttggagcatggatcgagattcaaaatgactagcgatttcggattt
gtcactttggacctgactgatgtgtacgagcgggactctgggatttatacttgcaaagct
tacaataaagcaggagaagcattcacttcgactactatttactgctcgacgaaggagaat
attattgagaggtctcaacatccgaagggcaaggaaggtctcgaggcaatccaagatctc
gaagaatccttgaaacgagctccgggagctgcgccagagagcgaagagggtcatccacct
gtatttacatctcaatttgagaacctgaccaacttgtctgaaggagagatcgctcacttc
gaagcctcccttacaccaactggcgatcagaccatggtcgtcgaatggttctacaacggc
aaggctttagaggccagtcatcgtacgagaacagtctacgctttcggtatggtcgttctc
gaggtgctcggaaccaagatagaggactccggtacttattcctgcagagccaccaacaaa
tggggtcaggctgagatcagcgtacaactagaatgcgtggacaagtctaaaggacaaaag
cccaaatttacgacacacatacaatcattggaaggtcttaaagacggtcaatcagcgcac
ttcgagtgcacgttgattcctgtcggcgatcctcatatgaaagtagaatggttccataat
ggtcaaccgctcagacactcttctagattcaagatggtgtccgattttggatttgttgta
atggacattgctggagtgatggcccacgatactggagaatacgtgtgcaaagctagcaac
aaatttggtgaagattacaccaaggctactctgaagtgctttgggaagagtggagtgtac
ctcgattcgttgcagcctgactctcttgcgaggattagagaactggagagttttggtggt
gaacagccaaccacgccgactactccagttgccgagccgccgaaattcatcacccaaatc
gttgacatcacgaaactggtggagggacaatcggcgcacttcgaggccagacttacgcct
gtgaccgatccagacttgaaggtcgaatggtactacaacggcaagaagctgccgcatgga
cacagatacagaaccttccacgattttggtatagtcatcttggatatattgtactgttac
gaagagaactctggagtatacgagtgcagagcattcaataaatacggggaagatagtacg
aaggcgacgttgaagtgctactcgaaatcgagtctcattttggagtcacagcttccaaag
ggaatggaaggtggcttggaaaaaatccagactttagaagattctatgattcgtacgaag
gatgagaaggttgttgaggaacgtggcaaagctccgatgttcactgtaccattgagtaat
atagatggtcttcgcgagggcgagagcgcgcatttcgaagctaggcttacacccactgac
gatccaaaactaaaggtcgaatggttctggaacggaaaaccactgcgaacgggatctcgt
ttccgtacattctgcgatttcggcttcgtgatcctcgagatttcaccgatctacccggag
gattccggcgaatacagctgccgtgcgacgaacgagtacggcgaggctgtgaccacttgc
acgatgaagtgcacagggaaacgaagcatcattctcgagtcccaattgccgaagggaatg
gaaagtaccatcgacaagatcgcagagctggaaggcttgggagccgtgccgggcgaggta
actcctgacgacgacaccgggaaaccaccagaattcatcaccacgccgtctgatttgacc
ctggccgaaaacgctctggcgcacttcgagtgtagattaacgccgatccacgattccagc
atgagagtggaatggttccacaatggaaaagctctcctggctggaagtaggattaaaaca
attcacgactttggctttgttatccttgaagtggccaattgttatcaacgagattcaggc
ctgtacacttgcaaggcaactaatcgacacggcgaagcgacggtgtcctgcaagctgcaa
gttcgcggacgtcaaggcatcatcctggagcctcaattgccgaccaactttaaaaccgga
acggaaagcattcagaaattagaagaggctttgtacaagaaggacgagatcctggcagaa
gaagaaacacccaatcctccgaagttcaccgtggagctgaaggatatcgaggttgaggaa
ggagcatccagtcacttcgactgcagagttgaacctgttggagatcccactatgcgcatc
gattggttccataatggaagatcattcgctactggctcgcgtgtacaccagatcaacgac
tttggatttatttcattggacatgtcgtacacttatgccagggacagtggcgaatacgtt
tgtagagctaccaacaaatggggctctgccaccaccaaagctacaatcacttgcaaatct
aagaaaacaatagatttcgactcccaactgccatcgggcatgagcggtgagaagctgaag
gaattggaacgtggaccaataagcgaaccacccgcggaagagcccccgcgtcaaccaccg
aaattcatcacgcaaattcaatcagcaaccgtcgacgaatccgaaccagttaggttcgag
tgtcgcgtggaaccgaaagatgatccaaacctacgtatcgagtggtacagaaatggaaaa
ctgattccggctggacatagatacaggacaacgtatgatatgggattcgtatctatggac
attttgtatgtttatcctgaggactctggagagtacgtgtgcaaggctattaacgatctg
ggagaagacaccactagggcatcggtatcgtgcaagaaattgcccagcatcatattacaa
aatcaagtgccaaagggtatgaagaagtcggaagcgctgatgcagatggaagcaaccatc
aagaaatatacgtcagaagtgcatttgacggaagatgatttgtacgacgcggacaagaaa
cagccacctcgtttcgttacgcagattcaagaccaaaccgacttggtcgagatgaacacc
accaaattcgaatgccaattagcgcctgtcggcgatccgaacatgaaagtagaatggttc
ttcaacggcagaccgttacctcataagaacaggttcacgccgatttacgatttcggctac
gtggctatgaacttcggctgggtgtaccccgaagacagcggagagtacttgtgcagagct
acgaatctttacggaatggacgagacgcgagcagtgatacaaaccactggcaagcctggc
atcatttatgagtcgcagctaccgaagggcatgaagagtatcgagaagatcagagagatg
gaagctgcatggcaaatagtacctgaggaagagggcgaagaggagaaggtgcgggcacct
cctacattcgtcagcaaaccggaaccagtgaccgtcgaagaaggtgactgttccaggttc
tgctgtcgagtcactggccatccaagaccaagagttatgtggatcatcaacggacacact
gtagtcaacggttcacgctataagctaacgtacgacggcatgtaccatctggacatcccg
aagacgagacaatacgatcacggaaaagttgaagtgatcgccagaagttccgtgggcgag
gctcgcaccgagaccacgttgaccgtaaaaccgaggagcgacgattaccgcggtgtattg
aaaaattcgccgagaccgtggtatgattacgagctgacccaataccaagcggagcgacag
aacacagagctcgagaaagttttcgatgagagacaccacaacatctcgcaaggcatcgaa
atcgccacagagcaccttggtcagaaggtgttcaaggagccagaggccgaatggcagaag
accgtcaagacaaagaagaacgaggattattacaacaagctaatgaaccttgaggaagaa
caggtcttgaaggagagcaggctcagagaagctagtcatcaattcgctattcctggagag
aaggtcgttgcccagtctgtggccaagggaatggctcaacaatatgaagaaaccttggaa
ggaaaagaggagaagagggaagacaggagccaggagacgacgcagacccaacagaagttc
gtgaggaaaccatttacgacggaggtggatatagatgttgagcgtacgaaagctaaacat
ccaccagaaccgtccgagtcgacagttcacggtcgcgaagttcatgttgcaaaacagaag
caaacgcagaaagaacacaaaggcgatgtggagatcaccaggaaaataaccgccacagaa
accacggaagtggagcacaaagctaagacccaagaacgcgtggtccagggcccgatgaaa
ccggctacgcctccggtgttcaccaagaaaattcaaccatgcagagcgttcgagcaggaa
caggcccgatttgaagtcgagtttgatggcgacccattgcctaccatcaaatggtaccgt
gaggacttccccattcaaaattcgccggatcttcaaatctacacgttcagcactaaatcg
gtgttgattgtacgacaagtatttatggaggactcaggtgtgttctctgtcattgctgag
aaccgtgcaggaaaggccaagtgcagcgccaatttggtggtcgaggagcgtagacgacaa
cctggaagaggaggtgtgataccacctagcttcctatctaccattcaaaacacgtcggtt
accacgggacaattggctagatttgatgccaaagtgactggaaccaagcctttagacgtt
tactggctgaagaatggcaaaaaagtgacggcagacattcgttacaagacactcgaagaa
gacaacacttatacattattgattctggagacagtgccagaggattcgggcaaatacgaa
tgcgtcgctttgaacagcgccggagaggcccgttgcgatgctgaatgcgtcgtacgagga
cctcagtcgccaacgaaaacggcgaagccgacgacgccaggtgtcgaaaaagcaccagcc
gtctcagaaccattgagagatcaaactatcaaagagggaacatcagtcgccttcgcttgc
aggatcaccggaaaaccggtacccactgtgcaatggaagaaaggcgacaaggtcatcaag
ccgtccaaatacttccaaatgcaaaaggaaggcgacttatgcaccctaaggatctccgag
gccttccccgaagacgagggtgtctacaagtgcatcgccaaaaatccagctggtgatgta
acaacttcggccaaccttagagttctcgccccagacgcagctgacgttcttcctaaagtt
acaccattgaaagatcaagtagtcgtggaaggacaaccggctcaattcaagacccaagtt
actccggctaaaccaaagcctaacattcagtggtacagagaaggtgccctgattcctcaa
tcaccggatttccaaatgattcacgaaggtaacaatgcggtgctgctgatagcaaccact
tacgaagaagacaccggcacgttcacttgccgagctaccacttccgccggcaccgtagaa
acgtccgccaaactcatcgtcaaaaagagaaaaggagcgtattacgaggttccagctgag
actggaccaggcgcgaaaacgggtgtaaaaccgtcggtaggtttgggaacaggcggaaag
gacatagtcctggaacccttgacactcgacgagaacggattgccattagaaattcccttg
caacccggagacgagtcattgccctggagaaagggccaaattcgtcatcgacctcgactc
ggtgacacgacaccgtggcgaaaagccaaaccgaaatcgcgggacacttctttagataaa
ttgcaggccaccgaaggccaggtaaaaccatggacggaggaagcgataactttaaagaaa
actcctcaggtaccgcgagacatacccaaagaaaaattggaggacgtcgaattgaaaccg
gcgaagattgaaaggaaagagattaggaggcccagcttggaagctgttgatttgaaacct
gttacgaaagacgtgaaggaaatgaaaatcgaagaagagaggaagcttaaaaggcgagag
gcgacaggagagatttatgtggaagaagaggacaccagattcttgaaaactactaaaaaa
gtggatgaaactgtggaagagagaaagaaggagggaccgaaaccgtggaccgaagagaag
gtcacgctgaagaaagcaaaagtcgaaagaaaagagattcccagagaaactttagaatct
gttgaattaaagccttcacagattgagaagaatctgattgagaaaccgagcttggagaag
gtggatctgaaacgctttacaacggaaaaagttactgatgtatcgaagaccgaatacctt
gagcaggaagacacgtctatgttagacgtgagtagaactgaagaagttaagaaaatgaaa
aaagaaaagatagaagaaaaggtggagcaagcgaagccgtggacagaagagaaagtcact
ctgaagaagtctaaaccgataagaaaagagattgagaaggaaaccgtggagactgtagaa
ttaaaaccatcgaaggtcagcaaagctccgattcagaagccaagtttggaacaagtggat
ttgaaacctgtcccaacggttgtatctgagaagattactgagaaaactgagaagactgaa
tacctcgagcaagaagataccgctttgctggacgtttccaaaaccgaagaaataaagaaa
attagaaaagacaaaatcgaggagaagcttgaacagcctaaaccgtggaccgaagaaaag
gttactttaaagaaatccacgcctgtgaggaaagaagttgaaaaagagacgatagagact
gttgaattgaaaccatcgaagattaccaaaaccccagtccggaaaccgagtttggaggag
gtcgacctgaaagctgtgagaaaagagacaacggagaaaatagtaaaaaaagatgtggtg
cagaaggctgattatgtggaacaggaagatacgactttattggatattaccaaggatacg
agggtgaagaaaacaagaaaagagtcgatttcaacggagaaggtggaacaagctaagccc
tggacggaagaaaaaataactctgaagagagccaaaccggaaaagaaagaaatacctaca
gaacaggtcgagaaggtggaattgaaaccttcgaggccagagaaaccggaaatagggaag
cctagtttagatcaagtggatttgaaaccagttcctcagaaagtagcgcccacgacaaag
aaacctgaagagaaggatatatttgttgaaaaagatgatactacccttcttcaggtcact
aaggacgtcagagttgacgagaagttgaagaagaaaccggaagaagttgaaacaaaacct
tggactcaggaaaaaattaccttgaagaaaactaaagtggaacagaaagaaatccgcaga
gaatctatagaggaagtcactttgaagccaacaaaaacggaaaagaaggaagtaaagagg
gaaacgttggagaaagtagatttacagcaagtgactgacaaaactaaattcgttgaagag
gaagacacgaaactcttaaagatcgacaaagatgagaaagtagaagaagaaagaaaagaa
caaacagcgacttggaggagaggaaagaaaccaaaagagaagactccgtaccaagaggaa
gaagacaaaacgatcttggacgtaagaaaagacgtggaggaacaacagaaggaagtgcca
gtgccttgggccagaggcaagaagaaacctaaagaaaaagttccttaccacgaggaagaa
gataccactcttctcgatgtcgaaaagactgaaaagaagactgagaaacaggcgaaagag
gaggtgccggttccatggttgcgtggaaagaagccaaaggaagagaaaccagaattagcg
cccgaaagagtgcagcctgaacagaagccagaggaagaaaaattggagacaacgcaggtt
ccgtggcttcgagataagaaagtacagagaaaaataccggagaggaaagaggaaccggtt
gaggatattaaatcggtggcgttgaaaccggtcagacgggaacgtgtaccggaagagaag
gagaaaccggaggaagttactctgaaacctgtcaaacgcattccacgtgaagaagaagag
aaggaggaggtgcaactgaaacccatcccgaaacccaagcccgaagaaaagccacgcgag
gaggtaaaattgaaaccattcgagaaacctaaaccagaagtgccagaacaagaaaaagta
cagctgaaaccgtttaagcgagaaaaaccggaagatgaaaaagagaaattggtagcacaa
aaagtaccggagaaaccggaagaagaacagccgaccgaagttgatcaagtcacatggcgt
agaaaaccaaaaccaaaaaagacggtagttcctgaagagaaaccggagaaggctttggtt
ccacaaaaagtggaggagaaaccggaggaagagcagccaaaggaagttgaacaagtatct
tggcgtagaaaaccaaagccaaagacgacgatagttcctgaagagaaaccgcaggagaca
ttggttccacaaaaagtggaggagaaaccggaggaagagcaacctaaggaagttgaacaa
gtatcatggcgtagaaaaccaaagccaaagtcgacgataattcctgaagagaaacctgtc
gagaaagtcgaagaaaaagttactgagaaggtgaccgaggagcagaagattctggaagta
cttaaaagagaagaaaaagaaattgaagattggaaggccctagctttgaaaccggtaaaa
cgcggcaagaaacccgaggaacgagaagacaaggaagagatcatgctgaaaccagtgaaa
cgtcttcctaaagaggaagagactgaggaggagatcaaattgaaaccggtagagaaaccc
gaaaagaaagttgaaatgaaaaaaccgttgaaaacggaaatggtaggtccaactgcacct
gaggaagaaaagccagcagaagtgtcaaagttgccatggcaacgtggcaagaagaagcct
gccgaacaagaagaaaccgaagtgacgatcgaagagaagaaagtagtggaagaagagcag
aaagacatttctgaagtcagctggcggaaacccaaaaaggacaaggttgtgaaggaagtg
caaaaggaggtagaagttgaagacttctcggcagttgtgctcaagcctacgagaaaagaa
aagaaaacggaagagaagctagagaaagaggaagtgacgctgaagcctatacaaaaagcg
cccaaagagaaggaaaagccggaggaagtaacacttaagccggtaaaattggaaaaacct
gagacaattgaaaacggagaagtagaaaagactgaattgccttggcgacgtggtaagaag
ccagccaagaagatacttccacaggaggaaattaaacctgaagagactccgaaacctgaa
gaaagagcacccgagaccatcgaacaggtcaaggagcaaataatattgaaacccaaagaa
aagagaaagcctgaggaggaagaaaaatcggaggttaaattgaaacctgtgaaaaggtta
gagaaaccagaagaaaaacctgaagaggtaacattgaaacctgtgaaacgacttcctaag
gaagaggaagagaaagaggaagttaaattgaagccaataaagaaggagaaaccagaggag
gagaagccagaaataaaattaaaaccaattaaacgttgggaaaaaccggaagaggaaaaa
ccggaggaagtcactttgaagccggtgaaacgacttcctacagaagaggaaaagaaagaa
gacgtaaccctgaaaccaatacaaaaagaaaaaccagaagaaaaacctgaggaagttaaa
ttgaaaccgaccaaacgttggggaaaaccggaagaggaaaaaccagaggaagtgactcta
aagccggtaaaacgacttcctacagaagaggaaaagaaagaagacgtaaccctgaaacca
atacaaaaagaaaaaccagaagaaaaacctgaggaagttaaattgaaaccgtccaaacgt
tggggaaaaccggaagaggaaaaaccagaggaagtaactctgaaacccgtcaaacgactt
ccgaaagaggaggaagaaaaggaggaagttaaattgaaaccgataaagaaagagaaacca
gaggaagaaaaaccggaagttaaattgaaaccaatcaaacgtttggaaaaaccggaagag
gagaaacccgaagaagtaactttgaagccggtgaaacgtcttcctaaagaagaggaagaa
aaggaggaagttaaattgaaaccgataaagaaagagaaaccggaggaagaaaaaccggaa
gttaaattgaaaccaattaaacgtttggaaaaaccggaagaggaaaaacccgaagaagta
actctgaagccggtgaaacgtcttcctaaagaagaggaaggaaaggaggaagttaaattg
aaaccaatagagaaggagaaacctgaggaagaaaaaccggaagttaaattgaagccaatt
aaacgttgggaaaaaccggaagaggagaaacccgaagaagtaactttgaagccggtgaaa
cgacttcctacagaggaggaaaagaaagaagaagtaaccttgaaaccaataccaaaagaa
aaaccagaagaaaaacctgaggaagttaaattgaaaccgaccaaacgttggggaaagcca
gaagaggaaaaacctgaggaagtgactttgaaacccgtgaaacgacttccgaaagaggag
gaagaaaaggaggaagttaaattgaaaccgataaagaaagagaaaccggaggaagaaaaa
ccggaagttaaattgaaaccaattaaacgtttggaaaaaccggaagaggaaaaacctgaa
gaagttactttgaaaccgataaagaaagaaaagccagaggaagaaaaacctgaagaagtg
aaattgaaacctgtcaagcgtcttcctaaggaagaggagaaaaaggaagaagttactttg
aagcctattacaaaggacaaacccgaagaagaaaagccagaagtgaaactgaaaccagtc
aaacgtttggagaaaccagaagaagaaaaaccggaagaagttgttttgaaaccgatgaaa
cggcttcctaaagaagatgaagaaaaagaggagattaaattgaaaccgataaagaaagaa
atgcctgaagagaaacccgaggaagttaagttgaaacctgtcaagcgattagaaaagccc
gaggaagaaaaaccagaagaagtgaaattgaaaccagttaaacgtcttccgcaagaggaa
gagaagaaggaggaggttactctaaaaccggtggagagaaagaaacctgaggaagaagag
aaaccggaggttaaactgaaaccagtgagacgtatcgagaaaccggaggaagagaaaccg
gaagaagtgacactgaaacccgttccaaaaccggtaccagaaaaggcggaagagaaaccc
gaagaagaagaaacacaagaaacttcaatatggccatggcgacgtggcaagaagacaaag
aagatcgtcgatttccgggaagaagtaactgtcgtgccaatcgatcaagaaagagtggtt
tctgaagtaaaggtagacgaaacaactatcgttgaacagaaagtggaagcagaacaaata
attcagaaggaagttacagaaatcaaagaagaaaaaccggaagcgccggcgccttggaga
aggtccaaaaaagtggtcgaagagaaaatcgaggtagaagagataaaacctgaaatggtg
aaggaggaagagaaagtagtagaagaggtcaccgaagtatccgaagtctcttggagaaag
aagcgtaagccgaagaaaccagaagatgagaaagaaatcgtcgaactgaaaccagtcgag
agacatgaagaaattattgaaagcgtagaagaagtggttcttaaaccagtcaagaaagag
atagtacctgaagaagttaaggaagaaaaggtccatcttaaacctgtccctaaaaaacca
gaagaacaagaagttccagaacaaataactttgaaacctgttaagaaagtgaaacctgaa
gagaaaccgaaagaagaagtgccggaactaaaaccggtgaaagtagaaaagccggaagta
cctgaggagaaagaagagaaggaagtagcagttttggaaatgccatggaggaaacctaga
aggaaacccgaagaggtgcctgcacccgtaaaagtagaaaaggaagaagtagaaactgta
gttcaagatgttcgagtcaccacaaaaggagtaaaagtagagaaggctcccgaggaaata
gtcgaggtcgaacagaaagtagaggaagaagtccaagtcgaagagcgcaagagaaagcgc
aagcaacgtacacaggtcgatatatcgatcacagacaaagacaagaaaatcgctccgagg
tttatacaaaagttgcaacccgtaattgcgcaaccggaaacaaccgcgagattcacttgt
acagtatttggcaatccgttccccgaaatcgcctggtacaggaacgagcaggaacttcac
gccagcgagaagtacatcataaccatctacgagacgactgcggtcttagagataaccaag
gtcaaggaggaagatgctggaatgtattcttgtagagcatcgaatccggctggagtagct
acgtccaccgtgaatctcgtgatattcgaaaaagaagaggaaggcgtggcgccgcacttc
gcgacacctattaaacctctaatggtcgaggagcacaaaccagctctactcgagtgcgtt
gtcaccgggacacccatgccggaagtcaagtggtaccgcagggagcaagagctgcagccg
caaaaaggcaaagagatcacgttcaatcccgaaaccggcgaagccaagctgcacatactg
gaaccaaccgaagaggacgaaacgatttatcgcgtgcaggctgtgaacaaattcggccgc
gccgagtgcagagcgaacctggttattcgaagcgtagtgaaagttagcaaaccggaagtc
ctaagggcaccgaagatcaccagaccgttaccagctttgacagctgtgcgtggaaaacct
ttaaccttgtcagctgatttcgagagcacacctaagccagaggtgaagtggttcagaaac
ggaatcgaagtcacgccgtctgataaacgcgtgatcaacatttatgagaacacggccgag
ctgcatatacccgaagtaactaagaaggacggtggcaagtatgaagttcgggtagagaat
cctgccggcgaggcgaggacctcgggcactgttacagtgaaggaacacgaggacaagacg
gatgaagtgaaagctccgaggtttattgaaccgctgcaaccgcagatcgtcgctgaagga
gaagttgtcatcatggaaacgagggtcgattcctacccggcggcatccttccaatggttc
cacgaaaccactcctctggagtcgacaccacaggtgagaatcgtgacgcaagaaaacaga
tctatcgtgatgatcaaggaggtcaagccggagtacgccggcacgtatacttgccgcgcc
gaaaacgtagccggatcggttacctgcacggcgacgataaatctgctcgatacaccgtgg
gaggagaccgtcgaactagtctcgccgacgttcgccaggcgattgtcaccggtcagagta
atggacggtgagagcgcgaacctgacgtgcgtcgtgcacggaaaaccaacacccagggtc
gaatggtatcacgataacaaacctatcaaagagggcaaagagataaccatcatacaagac
acggaaggtgtctgcagtcttgccataactgaagtgttccccgaagatgctggggagtac
acttgtcgtgccgtgaatcctgttggcgaagccgtttgtacttcgtctttgattgttgaa
ggtaattcgaggtttttgataaaacttatggaaactccgttgttcgatacggacacggaa
gaatccgcaccagagataattaagaagcttcctcagttaattcctaccaaagatggagaa
ctaaccagactggaggtgaaggtgaagggaaaaccgaagccagaagggaaatggtacaag
cagggcgtggagatcgtgtcgtcgcaagaattccaaatcgaggagttcgaggacggcacg
tccgtgctaacgattgccgaaacttaccccgacgacacgggcgagattgtgttcgaggcg
cacaatccgctcggcgtatcgaccacgactacctatctgtcggtagaaggaatcctcgga
acaaaggagtacaggaaaccagaatgggtgatccaaatggaggagatgcaggaggctttg
agagccacgcaatctgtaccacgattcattcaagagatcaccgacgtttatgcgaaggag
ggtgaaaccgcgatatttgaatgctcatattctggcaatcctgctccagatgttgtatgg
cttaagaacgacaaaatgattatgaatacccagaacgtgaaagtacgtattctcgatgag
gagaaaaagacaacattaacaatcaaacacgccaccgaggaagacgatggaatttacgtt
tgtaaagctaccagtgagataggtttagcgatcaccaaagccaaacttcgcgtaacagac
gtaacgggtgagaggacattcagcttcgatgaagatgttgaagaacaggaaattaaacct
gagaagaagccggaagaagaaaagccgcgaaagaaaaagaagcccgagctgaagaaagcc
aaggaaacgaaggagaagatcaagactgaacgcgtaaaagttgataagaaggagctacgt
aaagagaagttagttcctaaggaacagccagaagaaaaaaaaattgttgacatcgaggag
actcaggtactcgaaacgacggaagttatcgaagagaaaccaactgaggtgtcaaaggcg
aaaaaagtggtaccgatccaagagccagtcatgacggaggcaattgcgtccatgaagaag
atcgacgatcagaaaccccgtgagatggtaccgaagcccgatgaacgtgcgaaaccagtg
atggaggaacgcgaaggggtggtcgtcatctcggaggtggccactgacgacgtggtgcaa
gactttactgtggaatcggtggtcgaccgcgcccagattacatcagaaacgttgcagaca
gtctcggtatccgaagtgcgcaccgaggcgagcgtccaagagatcagacgagtagacacg
aagcagcgaaaggcgaagaagacggtagtaactgaagaagagatatttgaagaaaaaccc
agagaggtggtcacagaagagaagccgaaaaagaagaagaagaaagtaaccatagaagag
gtcgtgaaaagagagagagaaaacattgcgaaagaggtggaagagattatggaggtgctc
catgcaaaggaattcggtccgggcgaagctccgcttcgagaattagccacaatcgggttc
ctagtcagacagggcgtctccgtaaacgagatcaacgagagcctgtataggacggataac
ttccccgcgttgaagacacccgaggctcagaatgcgctggttcaattggtggaaagagag
ggacatgggccgttgatcacgcaggttcttacggaggagacgactactgatgagagtgtg
gtggctgctaccgttgggttccgggcattcatgaggatgatcgagttgcaacacgtcacc
gtcgaggaggtgctcacccacttcgcgccggaagacttccggccacgagcttgggaagtc
acagaagccacagaagttgaaactgaagaaagggttacggaacgagtggacgtcgtccgc
aaaacggaggtccactttatggagaggcgggacgagagaaaagccgtccgcacgcaggat
attcgagacattaaagaatacgaggacacacggcaggcacacacaacactgcgcgaacga
aaagtaaaaccgaaggaacaggagagaaaggaagatagggacgagggggttcaggttgta
gagatcgaggaagtcgaggaaacggagaagaagaaacgaaaggacgtggaagaggtcgag
gaggaaaccgagaccataatcgttgaaacagactcgaaaggcagactgattcaaaagaaa
aaagatcgtgacgatttagagaaacgcgtagacgtcgaagaggaggaagagatcatagaa
aaagtgaggaaagagctgaaacctaaacggccgcaacttggccgagacgagattgaacta
gaagaaacagaagaattcgagatcaccaaagacaaatccgtgccttcgatcgctttgaac
gttcctagccaacgacatcaagtaatacctttagatcgcaccgtcgagcaagcaccaggg
aaaccagaattagagacagctaaattgactttagatacgatcacaccattgaccgagcac
ttggtgccggttcaagaaaaagaaatcgacgatattaccctgattaaaccagttgaacgc
aaagcgtccctttctatctcaccagtagagccatattctaccacagagaccactgtacaa
gccaccaccggcgaattcgctgataccttcaaacccacgacttacgaagcgacgccaggc
gtcgtttcatccgaaagcatcgtagtcagcgaaacattaaccaatgacgccgatgtgtcc
agtttaacaataaccaaacaggaattaagtagaacagcggatgtcagcgtgactctccaa
gaagccaccaccgtgtatgaaaccatggtgaatcaaaaagaagttccaactgaggatttc
gtgtcgccgttgactgccaaggctgaagacactttcttaccccaagtcgggctgtctgtg
tacgaagtccaagaaggcttgactgaggacaaattagagccgatgaaaactgtcccgact
aagcctagggtcaacgtgacagcagtcgaaccgttggttgtcgaagaagttagagctgaa
gataaaccaggtaaatattatccagagctgatagttcctaccgaagtagcgacggaaacg
gtgatacctcaacggcagagggttactgaagagatgcacgcgcctgaaaaggaaggcgaa
tacgttccaggcagactacctccgagccagaaagcgcaggttggaatgtcgtatggaaac
gaaacagcaatagtggagcaaaacgtcgttcaagagagcgaagggatattcgtttcagaa
agaaaaactgataccttcgaagccactcctaatgttactttgctcgaaggagtctctgtg
tccactgtccaaactcaggacactgaagttcatttgactattgaagaaacgaagaaagca
gtggctgatttgaatgttgttgagatcacttctgctgtgacagtggaaacggtgccttct
gagaaagaaaaggagtaccagccaggtgataagccagatgctaggacagccgagacatcg
atatcctctttggaaatcggctctatcgcgagcacgataattcaagaatctgaaggagtc
tatcaaccagatcagaagccaacgaaagcgctggctgaaacttctatcagacccgaagag
cacgtaacggtctcagaaattcagactgcggactatccatcagacttcaaagaggaactg
aaatacgttcaagaaagtggaaccgtttccgtacaattgacagaagcgaaactgatccag
gaaactttggcccatgatagtgaaacaaaaatggatgaaattgtaagaccagaagagcgt
gtagtggaaacgagttacgatgcgatcagaagcgtcgaggtgtttcagactacgtctgta
gaaaaagaagctgaattgaagatctttgagatgccagaatctcatcggggaaagaccgtg
ccgacgcatcctgtggtttcactggaaattgaaatgacccaaccggaagacaatttaggc
gaagttaagaaagatgtaccgtcgactggggtagctaaaatagaacctataggattacaa
gagacagttgtaggtgaaactgtagtagctgaagatgtagcaccagtacaaaaggacaag
gttccccagtcgatgatggctgaagtcacgatgaacgagattgaaagtgtgcacaccact
atggtagttgccagcgaaaaagaagcagagtacaccgaagtttctgaaattaaaggagct
tacgctagcacagaattcaccacacaggtcgccccagtgttcgaagaagtcagaacacat
tcaccaactggagagtacgtccctgaagagaagccagcttccggcgtagctcagccgtcg
catattccattagaaagcgtgacaattgctatgcaagagattgcagaaaaagaagatctg
tataagactgatatgaaacctactgagaagactgcgattgttgaattgactgaacctaga
cctggtccaactgtattagaagttattcctcacgatcgtgagaacatttacagtcccgat
gcgaaaccgcaggattacaccgctcagccgttggtctctggccacactgttgcattgaaa
tcggagacgttagtggagcagagtactggtgacatgagtatcgacaaacctaaatcagaa
aaagcgattcctcaacgagatgcattggaggaattgattataacagaaacgaacatcgct
gagacagagaagaccagagaggaagatatcaaaccgattacccagagtgctgagcttcaa
atccagtcgaaaaccgagaaattaactgtaactgaagtgatgagcgttcaggaggaggag
aaattggacgtggaggaaattccaaaagaaagaacagtcactctaggaatcactggagga
cacgaggtagctgagatgcaggaaactgtccttgcgagtaatatcaatatcctgaaggaa
gagaaggttaaagaagaacacgctggccagcaacaaaccggactggaagtcgtcgagcaa
acagaaatatctatttcagagaaagagtctccgttgcaaaaagatgtcaaacctgatacc
aagaacgttgaagtcaccttcgaagagggagaaggtatcgtggttggtatgacttatcca
gaagacaaagaaggaatattcactggggaagagaaaccgaaaggcgtggaagctacagta
gacataatcacccaaggagttgcttccaaattcgaagttcttactgacacaggcttgagc
gatttgccagatgaaaaagtccaagaggcgaaaccacatacaactatacttcctattgaa
gcagctattgccgaagaggtgcagaccagagaaacagaggcaccgttcagcgaaataaaa
ccatctgacaaaaaagcaaatctggaattcgtcactggtgaaggtttaatagtttcagca
gtcactacccaggataaagagagtattttaccagaagctgtaaaaccagaaacgaaatcg
gctagcttcgatattccaacccatatcgtcgctcaaactagtgagacgaccacgactgac
aacgtgggcgagtttaaacacgaggaagcagttcccgcgacagctacggctgaccatatt
ccgttccgtagcgtgattgcatcagaaacggctccagtcgatttagaaaagccgatggaa
gacttcgtgcagcctgacaagaagaatgtagatgttaccttcgaggaggaaataggagtg
acagtgacagaaacgatcgcgtcagataaagagaaagagtatttcaagaagctggagatc
caaggcgaacaggctactcctagcttcgacgcgcataaggttgcccagctaatggaaatt
aatccggctgcggtttctggggacttgactgtgcccgttccaacgacgggtgctgctaaa
gaggaacgattaccgtatgaaagtatcgttcaaaccgaaactatcgtcagtgaaactgag
aaggaattcaaagacaaacctgcgattacgaacaaagcagaaattaccatcaacgaaatc
atcagtgctactaccactactgaaataccagctgacaaggagggtacgctaaaaatccct
gagaaaccgggtgagaaacaggccagtgttcaattcgctggtcatattatagctgagaaa
acagaaataaccgtcgacgccagtgttggagagttagagaaagataaaccagtatctgcg
tctgctgtaccatctagtgtaccactggaagctctaatcagttcggaaacccagccaact
gaagctgaaggactgttcactgaagatcaagcgccattaaaagctctggctgacttgtct
ctcgtagaagaacaaagtattcaagtgtcagctgtagttttagaagataaagaggatgaa
tacaaatctaaggagctaccagaaatgaaaactgctggaaagagtttggtttccggtcac
gtagtcgcagagacgaccatgcaagttgtcgatttcagtaccggggaactggttgaagaa
aaaccaactggtgccatcgcggtaccagaacatattccattgataccactgatagaatct
caaactgtcgtacaggagagcgaggacaaattcgtaccaggtcaactaccagaaaacaag
accgcaatcgttgatcttgaagagggtagaaaaatcgtaacagtgtcccaagtaacaccg
gccgataaggaatctttatacgtttctgaagaacagccatcgaaacatgctgcctccgtt
ggtctggacacgacccacggaattgctgaaacgactacagtatctgtggaagattcggta
tcagaagtgaggatagaaaagccggatactaagaaagctatgtcgagccaggaagtacat
caaagcgtggttgtcactcagaatatcgttcaagaccaagagaatatattcgaaggaaag
ttcaagccaactgtacagacagtagacgtgtccatcgaagaaggtaaacgtgtgactact
gtcaccgaagtcggcgtagctgacaaagaagaaatactgaagaccattcaagaagaaaag
acacgatctgcggtaccagctattgtctccggtcacgaagtcgctgaaaggtctgagatc
ataccacaacaaagtactggggaggtggacattgtaaaacctgtcacagcaactgcacaa
gtaggtcagaaaccgtttgaaacaatcgaaacgacagaacaagtcttggcagagaaggaa
gtagacacaatcaaagaattaaccatgcaaaagaccagtgcacgtgtaactgtggatgaa
aataggttcattgctatcaccgaagcgactacaacacaggatgtcgaagcagaattgtca
gccatgaagaagccgcacgaagaagtggcgaaaccagcaatggagggcaaggaagtcgct
gagcagatggaagtgaatctgagagaagggcttggagaactaccacaggctccacggcct
accacgttcgaggcccatccgactcaaaccactttagaaagcgtcgacgtgagggaaacg
gtaccgcaagaacacagcgcaacattcgaagagaagatgaaattagatgagcacagcgca
aaagtcagcttcgtggaaggaaagagcgtaaccgtctcccacgtaattactcaagataaa
gaagacaccatgaagataaagaaacatgaagagagcacggcagaagtgactctaacgaag
gttggcatggacgtggcgcagaaggctcaggtgttcgtcgaacagagcacaggatcggtt
cagccattggagaaacacgaagtgaaggcacatcctaaacaagatgctttagaaccgatt
atcgtggaagaaactccaagtgctgagagcgaaggaatctttgacaaatatcctaaagct
gtttcttcgacggcggtaccgacgttcgaggagggtcatggagtatctataacagaagtc
acatctgcggaggcagaagctgtattcaaagagaagaagttggatgcttcacaaacagcc
agcagtactattatcaccgaacgcaatattattgaaacaactacgatcgaatctcaggtg
aatattcctgataaggttgaagaggcaccaatcaagcctcaggtggctgttcctgaacaa
gataccttcgagagtgtaattgtaagcgagaacatagtcgaggagagtgaacgcaccttc
gagggcgtgttcaagccacaaacgcagaaagcggacgtcgatatccagaaagtgacttcc
ttacaagtttctgaaaccgttactgaggataaggaaagcattttcgatgtggtaccgaaa
cgggagggagtcagggcgactcaggacatcagcctccacgaaacagtagttggatccatg
gtggaaagcatgcagagtacccaggagatccacgaggaaaaacgagcatcctctcaagca
acaatgacgcagactacgatagaaacagctgtcaagatggagacgactctgggtgaagtc
gaggacacgtttgagaaagagttcaaacccgaaacacagaaaggcaagcctcaaatggag
ggtctcaccactgttacagtcacagaagttgtatcgaatgaaatcgaagacgtcttgcca
gaggtcgtggctcctaaagagcaaacagctcagcctagcttgaccggtagagaagctcca
gaagtaacgcaagtggtcacggcagcaactactgaagaatttgaaaaaataactgaatta
aaggaacgacaaggcaaagtggaagtagaagaactatcttcagtaacagtttccgaagtc
atctctcacgaaactgaagatgtactcactagtaaaataatgcctaaagatcagaaggct
gacttcaatattctgggccgtgaagctgcggaaacgactcaagtaatgactatgaccgga
acagaagaccttacattgaaacgaccggaagaacagaaaggaaaaccaaaactggatgaa
ttaactccgcttacagtgtctcacgtagtttctggcgaagctgaagaggcgttaccaact
gccgaggttccaaaggaaacgactgctcaaccaagtttgactggaagagacgttgcagag
acgacgcaggtattaacagtcgcgagtgctgaagagatgctggcgccaaaagcgccggag
gaacagaaaggcaaaccgcaggtggaagaattggcgccgttgaccgtctcgcaagtcgtt
tcgcaagaagcggaaggagaattgcctacaccggaggttccagtcgaaagggaagctcaa
cctaatctaattggcagagacgtggctcaaacaatggaagttctaacgatgtcaaacgtg
gacacgttagctgaagataagaaaccaggagaacaaaagggagttcctggtttagaagaa
tttgttcctctctccgtctctcaaacaatttcatcagaaatggaggatgtgttacctact
gccgaggtacctacagaaaagttggctcagccgagtctgactggtcgtgacgtggctcaa
acaatggaagttctaacaatgtcaaacgtggacacgttggctgaagatacaaaaccagga
gaacaaaagggaattcctggtttggaggaattcgttcctctctccgtctctcaaacaatt
tcatcagaaatggaggatgtgttacctactgccgaggtacctacagaaaagttggctcag
ccgagtctgactggtcgtgacgtggctcaaacaatggaagttctaacaatgtcaaacgtg
gacacgttggctgaagatacaaaaccaggagaacaaaagggaattcctggtttggaggaa
ttcgttcctctctccgtctctcaaacaatttcatcagaaatggaggacgtgttacctact
gccgaggcacctacagagaagttggctcagccgagtctgactggccgtgacgtggctcaa
acaatggaagttctaacgatgtcaaacgtggacatgttagccgaagatacgaaaccagga
gaacaaaagggagttcctggtttagaagaattcgttcctctctccgtctctcaaacaatt
tcatcagaaatggaggacgtgttacctagtgccgaggtacctacagagaaattggctcag
ccgagtctgactggccgtgacgtggctcaaacaatggaagttctaacaatgtcaaacgtg
gacacgttagctgaagataagaaaccaggagaacaaaagggagttcctggtttggaagaa
ttcgttcctctctccgtctctcaaacaatttcatcagaaatggaggacgtgttacctact
gccgaggcacctacagagaagttggctcagcctagtctgactggccatgacgtggcggaa
actatgcaggtattgacaatgataagcgctgagcttttgacaactgcactggcaccggaa
gaacagagaggaaagcctaacgtagaggaactgacttccatcacggtttctcagacagtg
tcacacgaaactgaggagaccttggacagcccagctgctccgagtacagtcactgcacaa
cctgcgctatctggaagagaagttgctgaaactagtcaaattttaactgtcactaatgta
ggggaattagagaaacccgtgctacctgaagaacaaagagggaaaccgctgttggatgag
ttgacatcgataacagtatctcaagtggtgtccagcgaactagaagacacgttgccatcg
cctgaaaagccgagcgagaaaatcgccgaaccgcaaatgactggaagagaagtggctgaa
actagtcaagttttaactgtgactaatgtaggagaattagagaaacctgtgctacctgaa
gaacagaaagggaaaccgctattggatgaattgacgtcgataacagtatctcaagtggta
tccagcgaactggaagatacgttgccatcgcctgaaaagccaagcaagaaaaccgccgaa
ccgcaaatgattggaagagaagtggctgaaactagtcaagttttaactgtgactaatgta
ggagaattagagaaacccgtgctacctgaagaacaaaaagggaaaccgctattggatgaa
ttgacatcaataacagtatctcaagtagtgtctagcgaactggaagacacgttgccatca
cctgaaaagccgagcgagaaaaccgcccaaccgcaaatgattggaagagaagtggctgag
aagacagaaatattaacagtaactaacgtcggagaattgcaaaaaccagaacaaccagag
ggtcagaaaggtaaaccggatgtagaagagatgagcttcatcacggtttcagaagtggtt
tccactgaagcagagacagacctaccagcaccggaagctcctaaaaaacgcagagctctt
ccacagatggacagcatcgaagtggcagagacatccgaagtgttaacaatgaccagtgct
gaagagcttccaaaaccaaaagcaccggaagaacagaaaggaaaacctcaactggaagag
ttgctttccctgtcggtatcagaaattgcatttggtgaggtagaaaagggtcttccaact
cctgacgagccaacgaagcaaacagctatacctagtttgatgggtatccaagtagctcag
aaaacgcaggtagttccatcagcagctactagtgaattagaagaaacagcgaaacctgat
acaaaacagataattcctgagcaaattccattcgaaggaattgagcaattgcaaccggtg
acacaagaaagtgaaggcactttcgttgttgagaaaacagccaaatcggccacggctgag
gtgtccttccgggtgtcagaaagcgttgaagttacgcaagtgacgactacggaacaggaa
tcgaaggaggtgatcaaaggcgtggccaaagaggtttcagctcagcccgacgtgataaaa
cacgaggtagctttgaaaactgaggtgcagcctgaggatgctgcggctgagttcaaggtt
accaagccggagagtaagacggctaaaggcgtcgaggagatacagcaaggtgtgatcgta
accgaacatctaaccgcaggcgagattgagtcagaactgctagagtctgtaatacctttc
gcgaagttagcgagcgtttctatcgaggcagaacacctggatcatgttgtggaaactaca
gaagtaccagcgcaacaacatcacatcacaatcacacaacacacaacaaaacacgaattg
ccacagcaacaatcggttgaatcagacacagaagtaatcgaggaatacacgactaagttc
aggcgcggtagcacagacgacgagaccgcggccgttaaaacaaagaaaacgattatacgc
aaaaagaagcctaaaaccgaggcagagaaagacaatgtcgtcgtcattgaagaggaactg
gaagacgtgaaatcgcaaataccatcgataccgaagaaacagttcatgcctatcgaggaa
gttacaacaattgaagacgttgaagaaataataccgagtagaattgatgaagctgaagaa
gtagtagataaacaagatgagaaagtcgaagtggaagtggttcaggttcaggatacagat
aaaactaaaaagattaagaagaaaattatacgtaaacgaggaacagcagaagaagtgact
gaagaagtaaagatagaagaggaagaaaagaaacctgaaagaaagattaagaaacccgtg
gaagaggaagtgccagaggaagaagcgaaaccgttaaaacctattgaaacagagcgcgta
acgccaaccgtagaacaagtggaagaacaggttacggtaacagaggaaacaactaaagaa
gggaaaccaaaaaagacaacaaggaagaagataattacaaggaaaggaaaagagcaacag
gtgaaagaagtagttacgattgaggagcaaggaaaagcaccagtgacaagcgtaactgaa
ggaccagttgaagaagtagtagaggaaatagtgaaacgcttaccaaagccagagtatgct
aaaccctcagaagtcgaagaagtcagggaacaagttacagtgacacaggaagtgactaga
tggggaaaacctaagaaagtgaccaagaagaaaattattaaacgtaaaggacagaagcaa
caagtgactgaagttgtcactgttgaagaagaaggaaaagcaccagttaccacagttact
gaagggccagtagaagaggtcgtagaagaacttataacaccattagttgaagaacagggc
aaagctccagtcacaacagttacagaaggacctgtcgaggaggtagtagaggagatcatc
aaacctctgcctactccagaaagtgttaaaccctctgaggtagaagaggtcagagagcaa
gtgacagtcactgaagtcgttactaaagaaggtaaacctaggaaagtaaccaagaagaaa
gttattaagcgaaagggtaaagaacagcaagtgacagaagtagtaacagaggaggaggaa
ggtaaagcgccagtaacaaccgttagcgaaggacctgtagaagaagtggtcgaagatgtt
atcaaaccattaccagtacccgaatttataacaccgtccgaagttaaggaagtgcgagaa
caagtgacagtaacagaagaaataactaaattgggtaaacctaaaaagaccacgagaaag
aagattacaaggcgcaaaggtcaagaacagcaagtgactgaagttgttacggttgaagag
caagggaaggtgccggtaacaactgtgaccgaaggtcctgtagaagaggtggttgatgaa
acgattaagcccttacctgcgcctgaatatgctaagccaggagaggttgaagaagttcgc
gaacaagtaactgttactcaagaggtaaccagagaaggtaaaccgagaaagacggttaag
agaaaagttatcaaacgtaaaggtcaagaacaaaaagtgacagaaatagtgacggttcaa
gaggatggaaaggagccagtgacaacggtaactgaaggaccggtagaggaaatagtagaa
gaagcagtaaaacctgaatttatgcaaccttcagagatagaggaagtgcgtgaacaagtt
acagtaaccgaagacgtaagtagagagggtaaacctaagaaaacaatcaagaagaaggta
attaaacgtaaaggaaaggaacagcaagtaacggaagttgtcactgtggaagaacaaggt
aaagctccagttactactgtttccgaaggacctgtcgaagaagtcgtcgatgaaactatt
aaaccgttaccagcaccggaatacgcgacaccaggcgaggttgaagaagttcgtgaacaa
gttacagttactcaagaaattagcaggtttggtaaaccaaagaagacaacaaaaaagaag
attaccaaacgtaggggttcggaacaacaagttacagaaattgtgacagttgaagaagaa
ggcaaggctccagtaacaacagttacagaagggcccaccgaggaagtggtggaggaagtt
ataaaaccattgcctattctggaaaaaattaaacccaccgaagttgaagaagtaagagaa
caggtgactgttacagaagaagtaacgagagaaggtaaaccaaggaaggttaccaaaaag
aaagtaatcaaacgtaaaggcaagcagcaacaggtgacagaagtagttactattgaggag
caaggtaaagctcctgtaacgactgtaactgaaggaccaacggaagaaatggtagaagaa
atcataaaaccatggccaataccagaatatgccaaaccatcagaagtagaggaagttcgt
gagcaggtgactgtgacagaggaagtaactaagttaggaaagccgaagaaaaccactaag
aaaaagattattaaacgtaaaggtacaacacaacaggtaacagaagttgtaactgtagag
gaacaaggaaaggcaccagtgacgactgtcaccgagggtccggtcgaagaagttgtagaa
gaattcataacaccattacctacactcgagaaagtgaagccaaccaaagtggaggaagtc
agggaacaagtaacagttactgaagaggttaccaaagaaggcaagcctaagaaagttact
aagaagaaagtcattaaacgtaaagggaatgaacagcaggtaacagaagtcacaactgta
gaggaacaaggaaaatctccagtgacgacagtcactgagggtcccattgaagaagttgtg
gaggaattagtgacaccattaccaattccgaagagaattaaacctagcgaagttgaagag
attcgagaacaagtaactgtcacagaagaagtgactcgagaaggcaagcccaagaaagtg
accaagaaaaaagtaatcacacgcaaaggaaaagtgcaacaagtgtctgaagtaataact
gttgaagaacagggtaaagcgcctgttaccaccgttactgaaggtcctacagaagaaata
gttgaggaaatgataaaagctttacctgccccggaatatgctaaaccaggtgaagaggaa
gaagtccaagagcaagtgacagttacacaggaaataaccaaagaaggtaagcctaaaaag
atcacgaaaaagaaagtgatcaaacgcagaggctcagaacagaaggttacagaaacagta
aaagttgaagaggaaggaaaagctccagtcacgacggtgactgaaggaccagtggaagaa
gtaatcgaggagactataaaaccactgcccaaacctgtgcgtatcgaaccaaccgaagta
gtggaagtaagggaacaagtgactgtaactgaagaagttaccaaagaaggtagacctaaa
aaagtaactaagaagaaagtcatcaaacgcaaaggtaaagagcaacaagtaacagaagtc
gttacagttgaagaaaaaggaaaagcaccagttacaaccgtcacagaaggtccattagaa
gaagtagttgaagaagttttaaaaccattgcccttgccagaatatgctaaaccatcagaa
gtggaacaaattcgagagcaagttacagtaacgcaggaaattacaagagaaggcaagccg
aagaaaataactaggaagaaggtgattaaacgtaaaggaagaaaacaacaggttacagaa
gttgttactgtcgaagaacaaggtaaaaggcctgttacgacggtaactgaagggccaata
gaagaattggtagaagaaatagtaaaaccattgccaatgatagaatatgttaagcccaca
gaagtagaggaaattcgtgagcaagtgactgtgacagaggaaataactaaattagggaaa
cctaagaaaaccaccaagaaaaagattattaaacgtaaaggcaaagaacagcaggtaacg
gaagtagttacagtggaagaagacggcaaagctccagtcacaacagttacagaagggcca
gtagaagaagttgttgaggaatttgtgaaaccattccctactccagagaaactaaaacca
attgcagtagaagaagtcagagaacaagtgacggttactcaagaaattactagagaaggc
aagcctaaaaaggtgacgaagaaaaaagtgattaaacgtaaaggcaaagaacaacaggta
acggaagtcgtaacagtggaagaagaaggaaagcgacccgttacaactgtaaccgaagga
cctgtcgaagaagtacttgaagagacactgaaacctcttccagcgcctgagtatgcaaaa
ccaggcgatgtggaggaggtgcgtgaacaggtaactgtcactgaggaaataacaaaggaa
gggaaaccaaagaaaactattaaaaagaagatcatcaaacgtaagggcaaggaacagcaa
gtaactgaagaagtgacggttgaagagaaaggtaaacgacctgttaagacagtaactgaa
ggacctgtcgaagaaattgtcgaagagacaataaaaccattgcctgcgccagagtttgtt
acaccatcggaagtagaggaagttagagaacaagtaactgtcacagaagaaataacaaga
gaagggaaaccaaagaaaactactagaaagaagattatcaaacgtaaaggcaaaaaacag
caggtaactgaggaggtgacagtagaagaacaaggcaaacgaccagttacaacagtgact
gaagggccagtcgaagaagttgttgaggaaatattgaaaccactgatagcacctgagtat
gccaaacctggagatgtggaagaagtacgggagcaggtaacagtcactgaggaaataacc
aaagaagggaaaccaaagaaaacaactaaaaagaagatcatcaaacgtaagggcaaggaa
cagcaagtaactgaagaagtgacggttgaagagaaaggtaaacgacctgttaagacagta
actgaaggacctgtcgaagaaattgtcgaagagacaataaaaccattgcctgcgccagag
tttgttacaccatcggaagtagaggaagttagagaacaagtaactgtcacagaagaaata
acaagagaagggaaaccaaagaaaactactaaaaagaagattatcaaacgtaaaggcaaa
aaacagcaggtgactgaggaggtgacagtagaagaacaaggcaaacggccagttacaaca
gtaactgaaggtccagtcgaagaagttgttgaggaaatattgaaaccactgatagcacct
gagtatgccaaacctggagaggtggaagaagtacgggagcaggtaacagtcacggaggaa
ataaccaaagaagggaaaccaaagaaaacaactaaaaagaagatcatcaaacgtaagggc
aaggaacagcaagtaactgaagaagtgacggttgaagagaaaggtaaacgacctgttaag
acagtaacggaaggacctgtcgaagaaatagtcgaagaaaccataaaaccattgcctgcg
ccagagtttgttacaccatcggaagtagaggaagttagagaacaagtaactgtcacagaa
gaaataacaagagaaggaaaaccaaagaaaactactagaaagaagattatcaaacgtaaa
ggcaaaaagcagcaggtaactgaggaggtaacagttgaagagcaaggcaaacgaccagtt
acaacagtaaccgaaggacctgtcgaagaagttgttgaagaaatattgaaaccactgata
gcacttgagtatgccaaacctggagaggtggaagaagtacgggagcaggtaacagtcacg
gaggaaataaccaaagaagggaaaccaaagaaaacaactaaaaagaagatcatcaaacgt
aagggcaaggaacagcaagtaactgaagaagtgacggttgaagagaaaggtaaacgacct
gttaagacagtaacggaaggacctgtcgaagaaatagtcgaagaaaccataaaaccattg
cctgcgccagagtttgttacaccatcggaagtagaggaagttagagaacaagtaactgtc
acagaagaaataacaagagaaggaaaaccaaagaaaactactagaaagaagattatcaaa
cgtaaaggcaaaaagcagcaggtaactgaggaggtaacagttgaagagcaaggcaaacga
ccagttacaacagtaaccgaaggacctgtcgaagaagttgttgaagaaatattgaaacca
ctgatagcacttgagtatgccaaacctggagaggtggaagaagtacgggagcaggtaaca
gtcacggaggaaataaccaaagaagggaaaccaaagaaaacaactaaaaagaagatcatc
aaacgtaagggcaaggaacagcaagtaactgaagaagtgacggttgaagagaaaggtaaa
cgacctgttaagacagtaacggaaggacctgtcgaagaaatagtcgaagaaacaataaaa
ccattgcctgcgccagagtttgttacaccatcggaagtagaggaagttagagaacaagta
actgtcacagaagaaataacaagagaaggaaaaccaaagaaaactactagaaagaagatt
atcaaacgtaaaggcaaaaaacagcaggtaactgaggaggtgacagtagaagaacaaggc
aaacgaccagttacaacagtgactgaagggccagtcgaagaagttgttgaggaaatattg
aaaccactgatagcacctgagtatgccaaacctggagaggtggaagaagtacgggagcag
gtaacagtcacggaggaaataaccacagaagggaaaccaaagaaaactactaaaaagaaa
atcatcaaacgcaaaggcaaaaagcagcaggtaactgaggaggtgacagtcgaagaacca
ggcaaacgacctgttaaaacagtaactgaaggacctgttgaagaaatagttgaagagata
ataaaacccttgcctgctctagaatacgttgaaccgtctgaagtagaaggtgttcgagaa
gaagtaactgtcacggaagaaataaccaaggagggtaaaccaaagaaaactatcaagaag
aagatcatcagacgtaagggcaaagaacagcaagtaacggaagaggtaacagttgaagag
caaggcaaacgacctgtgaaaacaataactgaaggcccagttgaagaagttgttgaggaa
atattgaagccactcataccatctgagtatgccaaaccaggagaggtggaagaagtacgt
gagcaagtaactgtcacagaagaagtaacgaaagagggtaagcctaaaaaggttaccaaa
aagaaagtcaccaaacgtaaaggaaaagaacagcaagtgactgaagttgtcacaatcgag
gaacatgggaaggctcctgttacaactataactgaaggtcccacggaagaattagtggaa
gaagtaataaaaccattgccagaaacttcaccagaagcaatcaagccatctgaagtagaa
gaaattcgtgagcaggtgacagtaacggaagaaataactagagaaggtaaaccgaagaag
attacgaagaagaaagttataaaacgtaaaggtagagatcagcaagtatcagaaatcgtt
actgtcgaagagcaaggaaaagctcctgttacaactatcactgaagctccgatagaagag
atacttgaagaaacagtaaaagctttgcctactcccgaatatgccaaaccaggcgatgag
gaagaggtacgggaacaagtcactgtcacccaagaagtcactaaagaaggtaaaccaaag
aaaactactaagaagaaagtcattaaacgcaagggtgaccagcaacaagtaactgaagtg
gtcactgttgaagaacaagataaagtccccgtaacaactgttactgaaggtcctgtagag
gaaattatcgaagaagcattgcaacctctgcctgcgcctgaagttattggtccatccgaa
ggggaagaaataagggcacaggtgacgatcacagaagaagtcgtcaaggagggcaaacca
aagaaagtcaccaaagtaaaagtaattaaacgaaagggaagagagcaacaagtgtccgag
actgtaacagttgaagaagagggtaaagctccagtcacgaccgtgactgaaggtcctaag
gaagaaatagttgaggagacgataaaaactctacctgtaccagaatatgctaaaccagac
gaagtagaagaagtgcgcgaacaagtcactgtcacacaggaagtaagcaaagaaggtaaa
ccgaagaaggttacgaaaaagaaagttatcaagcgcaaaggtccagaacagaaggtcaca
gagacggtaacagttgaggaggaaggaaaggcaccggtcacgacggtgaccgaaggacca
gtggaggaagtagtcgaagaaatggtccaagcattgcctactccgatacgcaggaaaccg
tctgaggttgaagaagtacgtgcacaagtaaccgtcacagaagaaattactaaagaaggt
aaacccaagaaggttaccaaaaagaaaatcattaaacgtaaagaaaaggaacaacaagtg
agtgagatcgttactgtggaagaactaggtaaggcaccagtcacgactgtcaccgaagga
cccacagaagaaattcttgaagaaacactaaaagccttgccagctccgaaatatgccaaa
ccgtcagaagtcgaagaagttcgcgaacaagtcacagttactcaagaaacaaccgaagaa
ggtaaaccgaagaaaacaactaagaaaaaggtggtcaaacgtaaaggaaaacaacagcag
gtgacagaagtcgtcacagttgaggaaccaggaaaaacaccggttacaagtgttaccgag
ggtcctgttgaagagatagtagaagatatagtgaaaccacttgttatgcctgaatttgtt
aaaccaactgaggtagaggaggttcgcgaacaagtaactgtcactgaggaagtaaccaaa
gaaggaaaaccaaagaaaattacaaagaagaaagttgtcaaacgcaagggaaaagagcaa
caagtatccgaaattatgactgtcgaagaagcaggaaaggctcctgttaccacagtcact
gaaggtcccacggaagaaatacttgaagaaacactaaaagctttacctactccaaagtac
ggaaaaccagacgaagtggaggaagttcgtgaacaagttactgttactcaggaaacaact
gatgaaggtaaacctaagaaagttactaagaagaaggttgtaaagcgtaaaggtaaacag
cagcaagtcacagaagctgttactgtcgaagaacaagacaaagctcccgtcacaactgtc
actgagagtcctatggaagaaattgtggaagaaagtgtaaaaacactgcccgtcccaaaa
ccgatcgagccaaaggaggatgaaacacctgaggaagaggttgtcacaaaagaaggtaaa
ccaaagaaaattgtgaagaagaaaattcctaagaaagtgccgggtaaagaggaggagaaa
cccgaagttcctgaacttcaggaagttccagtcgaagaagctaaaaagcctaagcctaaa
ctcaaacgcatgcgctccacagttatgaaattcgaatctacgaaacttgaagtacacgaa
atatctacggacaaacctctttttgctcaaatcaaattgcgcaagactccaacagtgaaa
cgaccggtagagaagaaagagaagcttcatcgagttcttttacgaagtcgaatcattcca
gtcgcatggccttcaccgataaaatatttgaagatcgaggagttggaaccaaacgaagtg
caaaacggcattttgtcacgcaacgtggaagaagctgcaactttgcccaaacccaagaag
aagaaggtaaagcgtttagaaaaggaaatagctaaattggaaaagttggatcaagaattc
gaggagttgaaaaaggaattaccgttggagaaacttgaagaacctgtgatagagaaaccg
gaaaagaaagtgaaaaagaaaaagaaacctgttgaagaagttaaagaaggtgtaaagttg
caattgatgaagatcacgatcaaagaacaaaaaccgatcaagccgaagatcgacgaacca
gctactcctctgtttgctcagattaaattgagaaaagctccgatcaagccaaaaaagaaa
ggcgagaaagaagagaaattcccgaagattctgctgcgcagtcgtatcgtagaacatgaa
tggccaccttcgataaagtatccagttataactgtcctcgagcccaattatgtacagact
ggtatattgtctcgtacgatggaagaagcattgaagatcaagaagatcaaacacaaaaag
atgaaattaccagaaaaagaaataacagaattggaaaaactagaccaagaatttgaagaa
ttgaagaaagttccgttagaaaaagtggaggaaatggctccatacgaacgtaagtcaaaa
ccgaaagaacctgaggaggagaaaccgaagaagttgaagataggcaaaggaaagatacgt
ccagcagaagaacaagaacctgaaactgtaaaattgaagaaaataccagagaaagtgcca
agtgttccggaagaagaggctaaagttccaaagaaaaaagatgaagtagataaacctaag
aaggaaaaagaggagaaagaatatcctgaattgaaaccattcgaaccttatgacatagat
cgtcctgaggtcgaattagaagaaatggaaaaaccagagtatcctgaaccagaaaaagaa
gaacctgataagataccaggcaagaggataaaaaagaagcctaagaagccagctcaagaa
accgaagctattccgatagtacctggtgttccgaaaccgaaggaacctgaagaggaagaa
gaaatcaagagaagaattcctgagagagaagctccaccagaggagccggagaagatcaaa
ctgaaaccttggaagaaacccaaggaggaaaaagaagaagaaaagaagcctgaggattat
ttgaaatttgttcccaatgacgatgacattgtcgagattgtagagatcgttactgtcgtt
gaagagatacctgaaaagaaaccgcgaaagataaaaaagaaaaagaccacgacgaaacgt
ggcgaaaaaccgactgtcgttgaagagacagtcatagaggaagaaggcgaattgcctata
gtaacggtcgatgaaatagtcgtggaaaagcctgttgaagaaattagggaagagattgta
acgagcgaaatcgtgaccgaggaaggaacgaagagaacagtgcgcaagaggcgcgtgagc
aggaaacgcgaaggtaaagaacgggtcatcgaagaggtgaccgtcgaagaggaaggtaaa
gaaccattaacagcaacaacagaaccctacgaagacactacaccagaaatacacgaaaaa
ccaaaacacaaaagaccgaaaaaaccaaaagctgacgagaaagtgacggaagatgtcacg
gaggaagtggtccaaaaggtcgaggaagtcaaaaagaaggttacaaagaagaggaaaccg
atcacagctgaggacgaagtaacggaggaagtcgtggaagagataataacggagataccg
gaagagcatgaagctcgaccgttagtagaagaggaagagaccgttacgattactgagcaa
gaagtacgcaaagcaccgaagaagaagaagaaggaagtggtcatcaaagaagaggaggag
atcttcgagactatcgagactccaacgcagaagatcatcaggaaaaagagacgtcctatg
aagaagggtgaaggagaagaaatcgtggtagaggaaataattgaaaaaccacgtcaagag
accatagagatggaggaacaacaaatagtagaaatcgtcgagacgccgaccaaaaaggtt
gtcaagaagaagaaggagatagtgaaagatgacggtgttcctgaggaaatcgtagaagag
atcattatcgaaaagccgcagaaagaaaaggcgaaaccaattgtggaagaagaaaaggaa
acggtgaaagtaacgaaggttgaatcgaagaaagcaccaaagaaaccagaagaggaaata
gtcgaggaagaagaagtaattgaaactattgaaactccgacgacgaagatcattagaaag
aaaccgaaagataagaaaggtaaaatagtggaagaagtaatacagaaaaccatagaggag
gcacaggctatggaggagcaagaaatcgtagaaattgttgagacaccgacgaagaagata
attaagaagaggaaggcatcgatcaaggaaggcaaagcgcctgaggaggaagtagaagaa
atagtgatcgagaaacctattaaagagaaagcgaagaaagcaattgtgccaaaggaagga
gtagaagtcacagaaattattactgaaacctctgtcgaaaaattaccagacgagaaagtt
aaaccagaggaagctaaagagaagccgtcagaaatcacgaaagaaaaagtggaagttaca
caggtagaagtgaagaaagcaccgaagaagaagaagaagccagttacagcaattgaagca
gaagagaaagaagaggttgttgaggaaataaaacctgaactcccgaagacggaaaaagcg
gaaccgattgttacagaggaggaaggcgttgaagtaacagaagtagttactgaagtgact
accgaaaagcttcctgaggaggtaaaaccgaagaagaagaaagttaccgaggttaaagaa
aaggaggagaaggtaacaacgaagaaagtgaaagtgaaggaggctccgaaagaaggcgta
cctgaagaagaagaacagccagaagagaaagtcgaagaacttatcacggagaagcccaag
aaaatcaaagcaaagaaagaagttacgcctcaggatggtgtcataactacggaagtggtt
cctacaactgcagaggaagagttacagatagaaaagccagaggaagacaaggcagtaata
acagaggagaaagaagaaagggctaaggtagaggaaaagaaggtgaccgtgaagaaggct
atgaaaaagaaattaacaccaaaggaaactgaagaggagcaagtagaggaaattgtagag
gaaattacaccagaagaaccaaagaaaagaaaggctaagaaaacgattcttcccaaggag
gagttacaaacaacagaggtagttcctgaagtcgcaacagaagagataaaagaaaagaaa
ccgaaggaagagaaagctgttccgaaagaggaagaaaaagtggaagaagaagcgagagtt
acggaggtttctgtgaaaaaggtacctaaaaagaaaaagaaggaagacattgtgaccaat
ggggaaataattgaagacaaaccaaaagtggaagaaattcctgaagaaaaacttgaggtg
aaggaagaggtagagaaagaaaagccggaagaagaaaaaccaaaagcaaagaaaccgaag
gtagagaaaccgttagaggaaaaaccaacagaagagaaaccactagaggaaaaaccgaaa
gaagaaaaaccagtagaggaaaaaccgaaagaagaaaaaccaatagaggaaaaaccgaag
gaagaaaaaccagtagaggaaaaaccgaaagagaagccaaagaagaagaaacctgtggag
aaaaagcctgccgttacagaagaggagcaaccggaagaaaaggtggaggaaatcgtagag
gagaagccgaagaaggtcaaggctgagaaagaaattattccaaaggaaactgtagaaact
actgaagtaattccggaggcagtcactgaagaattgccaacaaagaaacccaaggaacgc
aaagtagttccaactgaagaaaagcctgaagagaaaattaaaattaccgaggttcctgta
gaagagaaaaaggaggaagtgccggaagaaataccaaccgaagaagttccggagaagcct
aaagaaacgaaagttgtgaaaaagaaaaagaagaaggtagccaagaaagatgagatcgaa
gaatgggtagaaccagagtacgaacgacctgtactcgaacctatgccggagaagattcaa
tgggaaccaaagaagaagaaagaaaagaagcctttgccggaatccctgcagaaactagtt
cctcaaaagatcgagagaaaagagatcaaacctacaaaactgaaatattcagagcctacg
gaaacagttcaattcgcttcgatcaaactgaaaaaagtgtcagtcccgaaaaagaagagc
gtgggcgaggtgaaaatcccaaaaatcatgttacgaagcagaatgacattcatcgatgat
tatccccctgaattacaaattccagagataactgagctcgaagaaaatccagttcaagca
ggtatcctgtccagaaacacggaagaagctctggaagttctcaagaggaaggtgaaaaag
gttaagcttcctaagaaagaaatcacagagttagaaaagttagatctagaatttgaagaa
ctgaagaaagttccgcttgagaaggctgaggaaatggcgccgtacgagcgtaagccgaaa
aagccagcagagaaaccgaaagaaccacaaaaggtggtcgtaggaaaaggtaaggtgccg
gaggaagaaaaggtagaacctgaaaaagtcaaactgaagaaaattcctgaaaagaaaccg
gaagaagttgaggaaccattaaagaaaccggtgaaaaaggaacccgaaaaggaagttaaa
ccggagaagaaagagaaaccaaaaatgaaattagaacacgacgaattcaaacctttagac
ttcgagcgaccagaattggaaaaatatgaaccggaagaattcccgaaacctgaagagcca
gcaccggaaccagttccaaagccatacgaaagggaggagaagaagaagccggatcaagaa
atagaacaagttccaataataaagggtgtaccaaaaccaccagaaaaagaagaagaacca
gaagttaagttcaggataccgcagaaagagaaaccggaagaggaaccagaaacaataaca
ctgaaaccgtggaagaaagagaaaccggaggatgaaggcgttaaagaattaccaaagaag
gaagaggaagaagctcccaaagtacctaaagaggagactgaagaagtcaccgtgaagcga
aaagccaaaccaaagaaacccaaagagaaggctcctaaggaggaggaagtcacgttgaag
aagcctgaagagaaaaagccagatgaggttcctgaggtaatcgaagaaattacgctaaag
aaggaaccagagaaaccggtcgaggaagctccagctgaagttactattaagaaaccagtt
attgaagagaaggaagtggaagaagaggaaatcacaacagaagtcacgatgaaaaagaaa
ccaaagaaaccagaagaaattgtggaggaagcagtggtaaagaagccgaagaaaaagaag
cctgtgaaagaagaggaagctgtcgaaattacgatcaagaaggaagaagagaaggaagag
gttgaagaggttaaagaagaagttgttataaagaaaaaaccagaagagaaacctgctcct
gaagaagtaactgaagaagttactttaaagaaaccagaagagaaacccgaagaggtagtt
gaggaaataaagaaaccaaagaaaaagaaggcagtgaaagaggaagctgctgaagaaatt
accatcaagaagcctgttgtggaagagaagaaagaagaagaagtgccggagcaggtaacg
ttgaagaaaaagaaaccgaaggagaaacctgtgccggaagaagtgaaggaggagatcacg
ttaaagaaaccagtgccagaagaagaagagaaggtacctgaagaggtcaccgagcaaata
gagatcaagaaaccggtagaaaagaaacctgttgaagaaatagctgccgatgaagtcact
attaagaaaccagtgcctgttgaggaggagaaagaggaaatcgtagagaaaataacactg
aaaaagaaaaaaccgaaagagaagcctgtagaagaagtaacggaggaggttactttgaag
ccggtaccaaaggagaaagaaaaagcaccggaagaagtaaccgagaaggttgaagttaag
aaaccgaaaaagaagaagccggtagaggaagaagttgccgaggaaattactatcaagaaa
ccagtgcctgttgaagaggtggaagaggagattgtggaggaaataacactgaagaagaaa
aagccaaaggagaaaccagttccagaagaagtgactgaagaagtcactctaaagccagta
ccacctaaagtagaggaaaaggcaccggaagaagtaactgaaaaggttgaagttaagaaa
ccgaaaaagaagaagccggtagaggaagaagttgccgaggaaattactatcaagaaacca
gtgcctgttgaagaggtggaagaggagattgtagaggaaataacactgaagaagaaaaag
ccaaaggagaaaccagttccagaagaagtaactgaagaagtaactctaaagccaatacca
cctaaagaagaggaaaaagctccggaggaagtaaccgaaaaggttgaagtaaagaaacca
aaaaagaagaagcctgtaacggaggaagctgccgacgaggtaacaatcaagaaacctgtg
cctgtagaaaaggaagaggaagaaataatagaggaagttactctcaagaaaaagaaacca
gaagagaaacatgtccccgaagaagtaactgaggaagtaactctgaagccagtacctaaa
gaagaggaaaaggcaccggaagaagtaaccgagaaggttgaagttaagaaaccgaaaaag
aagaaaccggtagaggaagaagttgccgaggaaattactatcaagaaaccagtgcctatt
gagaaagaggaagaggaaattgtagaagaaataacattaaaaaagaaaaagccaaaagag
aaaccagttccagaggaagtatccgaagaagttacgctgaagaagccagtaccaaaagag
aaggaaaaagctccggaggaagtaaccgagaaggttgaagtaaagaaaccgaaaaagaaa
aagccggttgaggaagaggctgccgacgaaataaccattaagaaagtagtagttgaagaa
aagccagaggaagaggctcctgaagaagtcactctgaaaccgaagaagaagaaatcaatt
ccaaaagaagaagcagaaaccgaggtgactctcacaaaaccgaaaccagtcgaagaggaa
aaggctccggaggaaataacggaaaaggttgaagttaagaaaccgaaaaagaagaagcca
gtggttgaagaagaagctgccgaaataactgttaagaaaccagttcctgtggaagaggag
gcgcccgaggaatttaccatcaaaaagaagaaaaaaccggaaaggaaaccgtctgtcacg
gaagaagtcgaagaaactgccgttactataaagaaagctcgtgctcctgaaaagccaact
gaggaagaggaagtgacaacagaagtacagttaaagaaaaagaagccggttccgaaagtc
acggaagaggcagccgaagaactgactatcaagaaagtagaggaaatcgaacagcctgag
gaagaagagatccacgagtttacgttcaaacgaaaacctccgaagctacctcccaaacct
atcgaggaaatctacgaggatgttactcttcgcaagttgcgtccaaagaaaaagaagcca
gacatcaaggaggtgacggaagtagagaacgtgacgttccgaccacggtccacaaaaacc
aaagaggatgtggaacaggaattcaagatttcgttgaacacctacgaggaggaggacatc
tccatgtccggtaaagttcgtttgaaaccaaagaagaaaccgatgacatactccgaagaa
gcaggagaagagacaatcaggattatgcaggaggtcgaagacgattctggtccaattata
gaagagatcatagaatcagatgaagaaggcggagatgaatacatgatcgaggaattggag
acagacgagatgaggctgccactgaagagaaggaggaagaaggaacgcaagccttataag
gtggaagacgtcgaggagggtgacgtaaggttgaaactgaaacatgaaaggaaatattca
attgaagaagccgacgagacgttagcgctgaagctgaagggcagaagacgcgtatccacc
tatgaagaagaagaggcctcgcttagtatcaccagggaagaagatatttcagagggagaa
gaaattgagtatgtaattcgcgatggcgacacgatgttctcgatttgttcgtacgtggca
gaaaccgacgaggccatcaacctcgttgaaggagaaagagtttacataatcgatcattcg
aaccaggactggtggttcgtaaagaaacacttgacagaagagaagggttgggtcccagcg
caataccttcttaatgaagtacattacactctctacctgcagcgcaaattgcatgagaag
atcgataaattacctgtcttcgaaaaaccagtacccggtgaggaaacatcagcaccgaaa
ttcattgagaaattgcagccgattcacacgccagatggttacacggtccaattcgagtgc
caagtggagggtctaccgagacctcaaattacgtggttccgacagacagccatcatcaag
ccgtcccccgacttccagatgtactacgacgacgataacgttgctacattgatcattagg
gaagtattccctgaagatgctggcaccttcacctgcgtcgctaagaataccgcaggcttc
gcttccagtaccacagaattgacagtagaagcacctctttctgaccacggatcggacgtc
actggtccatccagaaagagtctctcacgagaatcatccctcgccgacattctggaggga
ataccaccgacattctcgcgcaaaccgaaagcgaagtacgtgaacgaaggtgaagacgta
atactggaatgccgtttggtggcagtgcccgaaccggagataacgtggtactacaaggac
acgcaaatcactaacaaagagaacatcgccgtagctactgagagtgatatgcacatgtac
tgcagcgtgattaagataactaaagttcagaagaaacaggaagggaaatacacgatcgtt
gctaggaatagagaaggggaagctaccatcgagattcctatgaaggtgaagacaggcaaa
tccgagccaccagagattttggaacctctgcaatcatacgttgtgagagaaggcgaaact
gtggtactgtcagcacaaattgtcggccacccggcacctaaagtaacgtggtacaaaaat
ggtaaaccattgaagaccttaacaccgaaacaagacggccacgtaaacacgctcacgctg
attcaaccgaaagtgacggactctggagaatactctgtggtggctaccaacgatctcggc
acagccgaaacaaaagccacattaacagttgaaaaaataccaagtggagctccggaaccg
ccacttttcacggaacgattccaagggctcactgttccggagaaaggtaccttcaaattg
gtggccaaagttactgggaatcctgtgccagaagtcacgtggctaaggaataacaagccc
ttagaaaaatcgcctaatatcactgaaagctacgatggcgagaacatagcgttggaaatc
agaaacgcggattcggaagtagactcaggcgattacaagtgtatcgccagtaatcctgtt
ggaaaaacatctcacggtgccaaagtcacagtggacgtcgagaaagtaacattcacgaag
acactgccgaaggaagttgtcatcgacgaattcaagactttagaattgacttgtgaaaca
tcccacactgtgtccacgaaatggtggcacaacgacaaggaaatcagtggaatggaccat
cgggagatcgtgcaagatggacatgtgcacaagttgatcatcaagcgaacgagttccaag
gacgaaggaacttacgagtgcactgtaaagaatcagtcgacgtcgagcaaagttacagtc
aaagccaccaagccagagttcgtcaaagagttacaagactgcgaagtgaaagagcgcgaa
atcgccattctggaagtcgaaatcacatcggaaacggctgatgttaagtggttcaaggac
ggcgagcctttgggaccgggtaaagagaaattagaatttgtgaaagatggcaccgtcagg
aaattgctgatcagaagtacgtcggttcacgatgaaggagaatacacgtgcagtctcgcc
gaccaaaaatgtactgctgaagtcaccgttattgaattgccaccggaaataatctcgaag
atgcaagatgtgacaatagcgagaggcgagagagcgacgttcgacatagaattaacaaaa
ggagacgcaaaggtccgatggttcaaagacgggcaagaggtacagttctccgaacacgtt
cgattatcgatcgatggcaaaaaacagaagctgaagatctacgatacggaaccggaagac
gcgggtgtctactcctgcgaagttggcaaacaaaaatcatcggctaaattaacggttgaa
gaacctggagtagatttcattaccaagttaccagatgtgactcttgtaccgatgaacgcg
gacgctgttttcattattgaattatcacgcaacgttccagtcacatggttgagaaaaacg
gaagttatcaaggagtcaccgaaatacactattattgatgagggcaccgtgaagaagctt
atagtgaagaagtgtaccactgaagatatttcagaatacacagctgtcgtaacgaacgtg
aaaacatcatcgaaattgagagtcgaagttgttgaaacggcgccgaagatcagcccggag
acaccgaaaaaatacaaagtaagaaaaggcgaggacgttgaaattatcgtgaaattcacc
gcggcaccaaaaccagacgatgaatggacagtaaacggtcgcgtggttacaaaatcgaaa
cgagtggtgccgtcgatcgacgaggaatccgcggttctaaacatctaccagattgaagag
gacgacgttggcgattatactttgaaactggtgaataacgttggagaagctagcatagag
atcaacgtcgttatcgtccaggtaccaagtgctcctggagcaccagaaccactagagata
actaatgatagtgtgacgcttcactggaagaaacctgattcagatggaaattcacctatc
gttgagtacatcctagaacaacaagaaaagactgaaactacgtggaccaaaattacggaa
acgataacagaaactactcataatgtaacaaaattaaccacaaacagagagtacgttttc
cgtgtaacggctgtaaatgaagctggaccgggtgaaacttcgccaacttctccaaccata
aaaatatctaaaccatcggctgcagaaccaccagttgtactggaaccactgaaaagtgtc
attgttggccttgacgaaaccgtcaccctatcttgcgttattagagggacaccgttgcct
gagattacatggttgagaaatggtgaaacgtttgaagacagcagtatcacgtacgagaat
cgtgtggcgaaatacacaatcacaaaaactacagaaacgtcatcggcaacgtttacagta
aaagcaaagaataatgtaggaacagcagaaaccacgtgcgaattgaaggtgcaagaggcg
ccaaaaatcagctacgacgagaccctggctagtcagactctcccggtaaacgagcaatgg
aaaatcgagattcgaacgagcggcttcccgaaaccggaagtaacgtggtcaaagaacaac
aggagtatagtcgacaaacgtgtatcgattcgcacggaagagaatacctctaccatctct
atttcctcacttatcagagaagacactgccacttacaccgcgaaggcagcgaatcagact
ggcagtgcttcggttgacctacacctcaaagtgatcgacaaacctagcaaaccggaggga
ccagttgtcttcaaggagatcagacaggatcgtgtcaccatcgaatggaaaccacctatt
gacgatggtggaatcgaactcgagaaatacacaattgagaaatgggaaccaggcaaagct
tggacgaaggtggtcgatatcgataaggaagtggagagcttctgcgtgcacaaattgcaa
cagaatgcagaatacaaattcagaatcatcgccaagaacaccgttggaccgtcggaacca
ttggaatcggaaacggtcaaaatgagaacttccttcgaaccgccgggaccaccgagagga
ccgctagaagtgtcaggaatgacgaagacatcgttcacgataaactggcagcctccggag
aacgatggtggaacaccgataacagaatacatcatcgagatgaaggaggaatcgaagaag
gcttggcaaaagatcggcagcacgaagcacgaaacgacacacttcagcgtgtcggatttg
aaaacggatgtgccgtataactttaggataacggcgaaaaacagcgctggcactggacct
ccttacgttgctgaagaaccgatttcccctggcaggcgaatcaaaataacaaaactcgac
gaaagaaccatgtatgctctgctgggtatattcccaccaactgcaataattatcagcaag
acaccaccgtcaagtccacaacatgtacaagtaacacatgtgaccagcaagagtgcaact
cttagttggtctccaccagtcagcaatggtggcacagagcttacaggatacgtaattgag
aagaggccactgattggaaagggcgcgagatggacgaaagtggctacgctggagcctact
caacttcaatattgtatagaaaacttaaaggaaagcgaattcatcttccgagtgtttgca
gaaaacaacatgggactcagtttacctacgaactctgaaccagtcaccttaatgacgcat
gccaccgtgccgtcaccaccgactgcgccattggagatcagacaaatcgcagcgaacacg
gttgtaatatcgtggggaaggcctgaaaccgatggtggtgcgccattggaggcctacaag
attgctatcaaggacgcaaagaagactatgtggatggaagttggcagagtgaacgccgac
gtacagaagctgaacatcagggatctacaggagaaccacatgtacttgatcaggatctac
gctaggaatgaagttggctttagcgagcctttggaatcagatgaaccggttaagatcgta
ccagtttccgaattggcagtagtggagccgatcgctgaagtcaccgagaaaggcgaaacc
gcatcggtgagcttcagcacagagaacacgagttcatggcttcgagatcataacatggat
gccgacattcatacatacgcgagagcaagactcctcagacaagacgaatacttcttccgc
atttggcactatgccaagaaactcttcaaagaataa

DBGET integrated database retrieval system