KEGG   Ceratina calcarata (carpenter bee): 108632911Help
Entry
108632911         CDS       T06061                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7 isoform X2
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ccal  Ceratina calcarata (carpenter bee)
Brite
KEGG Orthology (KO) [BR:ccal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccal04131]
    108632911
Membrane trafficking [BR:ccal04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    108632911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 108632911
NCBI-ProteinID: XP_017893276
Position
Unknown
AA seq 1988 aa AA seqDB search
MSSVQRAFTQKLSKQHAADVRRQIANSTSYSRDLSKSGSSFSGFSSTMSLCEVLEPLDYE
EFLAQHQSVLDRDPLKSILDFPPGDVELKVVKRKIRTEEPVVPFESLDTVSPYVRRCIES
FTSDWVVVHRKYKRRVSPIARDRLLQDTPRQDFEVDQEDTNGSGSPNEEEDLSNCGDTPR
GSWASLDLRHSQHDPLLPTLLDRVCPETVDQMNEQKRSEDRQEALFPLYSPPTSPDDEWQ
EISIAPEPSEPFSHKILVKCLQLKLELEVEPIFASLALYDAKEKKKVSENFYVDMNSEGL
KRMLGGHIAYSDASTLARSCVMSVSKPSPDLFLVVRLEKVLQGDISECAEPYLREDKNKD
KVRAAAVAACERLGRYRMPLAWTAIHLSGVIGGGGDTDSTGSAGSLDRKSGGLEQWRKKV
EPPARRGSLERRSSDKRRSWSPDDFANCLDTFRPITLTVSSFFKQESERLRDEDLYKLLV
ELRRPGSNLKRLKCLPGILKLDLSPRPEELPRCLDPDLRRLVPYPDEKSRPVKEILEFPS
EVISPDLTYRNLLYIYPKEANFSSRTGSARNIAVRIQLMGGEQEADALTAIFGRSSCPEM
THECFTSVSYHNKNPNFYDEMKIRLPADLSAKHHLLFTFYHISCQKKVEQPNVETAVAYT
WLPLLRDGHLQSGEFSLPAMLDPPPANYSYIAPDVLLPGTRWVDAHRGVFTVILEPVSSV
HPQDKYIDRFLSLCGFLETGQVPPRIGEAGMESELKSALLELARASHSALVRSLPQLLDQ
LISLLVRPPTLPSQPLNIAATVFEAIGLLVRNITNLPDGQLDAHGRHALLATYVAYQCSL
PQMTQAPGIVRAQSNPDLPLEDLEMEIHSRGLDRTASMRQESPSINSQPTRRLLHEELAL
HWVVSTGQARELAVTYSWFFLELIYRSMVVTLAEMGMLEVPRKSRFSPQFCDDVATLTAA
LTSEVISRCGKDTRVPNNLIFSLGNFLSDLLSVMDRGFVLSLIRAACCSLSDASMHIPDS
AALYALKLDLVRTVCSHEHYVALNLPFGTGYTSGSAPASPSPSTGSSGSLISTLVPGDRA
RFSELSQEFRQQHFLVGIVLSDLSNTLEIPNPMLQNKAIGSIRHLMACHDVDSRYTDPSA
KARVAALYLPLLNIIMDALPQLYHWDSKDKSVYPDESGSITQSVALAIAGGVSAETAGAQ
CRVSLSSEATRHLLMCVLWVLKGLEQSALAQWCAELSSRRILCLLQVLNIATAAFEYKGK
KALKRLPPQAAATSDIRSRLEDVILGQGSARSEMMLRRKERMSGDKLRWRKDQMPYRSCE
QSEARAVEQDAHIEGALAAEASLVVLDALETVVQADGGGGAVVGAVLKVLLRALARNQST
SVLQHMFNTQRALVFKYHSALFDEESERCGDLCLTLLTRCSSPLSAVRSHAAASLYLLMR
QNFEIGNNFARVKMQVTTSLSALVGRGRAPSEGALRRALKTVLVYAERDTELADTSFPEQ
VKDLLFNLHMILSDTVKMKEFQEDPEMLLDLMYRIAKGYQGSPDLRLTWLANMAQQHMER
KNHTEAAMCLVHSAALVAEYLHLLEPGGGGRPVGAVALAPVTPNALEESAVGDDVLARRE
EGLCLGPDFSESGLAGLLEHAASSFHAAGMYEAIPDVYRVLLPIAEAAHDYKKLANIHGK
LHEAYTRVEQLAGKRVFGTYFRVGFYGSRFGDLAGEEFVYKEPTLTKLPEIFSRLENFYA
ERFGAENIVIIKDSNPVDPSKLEPDKAYVQITYVEPYFEPHELRHRPTIFHRNFNIKRFV
YATPFTPGGKAHGELREQCKRKTILTVATHFPYLKTRIRVVARKQIVLSPIEVAIEDIQK
KTAEVAAATAQEPPDAKMLQMVLQGCIGTTVNQGPAEVAVVFLSGLREQNAQPTRLQHKL
RLCFKDFSKKCLDALRRNKNLIGPDQRDYQRELERNYQRLTERLSPLIAWSGPPLGSQQN
IPTTSPRW
NT seq 5967 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctgtacagagagcttttactcagaaactgagtaaacagcatgcagctgacgtt
agacgtcagattgctaactctacttcgtattctcgcgacctgtcgaagagtggcagctcc
ttctcaggcttctcctctacgatgtcactgtgtgaggtattagagccattggattacgaa
gaattcttggctcagcatcaatcagtacttgatcgcgatcctcttaagtcgatattagac
ttcccacctggagatgttgaattaaaagttgtgaaaaggaagatcagaacggaggaacca
gttgttcctttcgaatccttagacacagtatctccttatgtaagaagatgtatagaaagc
tttacctctgattgggtagtagtgcacagaaagtacaaacgcagagtgtctcccatagca
agggacagattgctccaggatacaccgagacaagactttgaggttgaccaagaggataca
aatggctctggatcaccgaatgaagaggaggatttatctaattgcggtgatacgccaaga
gggtcttgggcaagcttggatctgaggcattcgcaacacgatcctctgcttccgactctg
ttagacagggtttgcccagagactgtcgatcaaatgaatgaacaaaaacgctcggaagat
cgtcaagaagcattgtttccgctttattcgcctccaacttcgccggacgacgaatggcaa
gagattagcatcgcgccagagccatcagaacctttttctcataaaatacttgtgaaatgt
cttcaattaaagttggaattggaggtcgaaccaattttcgccagtttggcattgtacgat
gcgaaggaaaagaaaaaggtatccgaaaacttttacgtggatatgaattcggagggattg
aaaagaatgcttggtggtcatatcgcgtatagcgatgccagcacattggcaaggagctgc
gtgatgagcgtcagtaaaccgagcccagacttatttttggttgtcagattggaaaaagta
ttgcagggtgatatctcggaatgcgccgagccgtatttacgcgaagacaagaataaagat
aaagtgagagcagccgctgtagctgcgtgcgagcgtttgggtcggtacagaatgccgctt
gcgtggactgcgattcacctttccggtgtgataggaggtggaggagacactgatagcaca
ggaagcgctggttctttagacagaaaatcgggtgggttggaacagtggcgtaaaaaagtg
gaaccgccagccagaagaggctcgttggaaaggagaagctcggacaaaagacgtagctgg
tcgccagatgattttgctaattgcctggatacatttagaccaatcacactgactgtttcg
agtttcttcaagcaagaaagcgaacgtcttagagatgaagatctgtacaaactgttagtc
gaactacgaagacctggttctaatttaaaacgactcaaatgtctaccggggatattaaaa
ttggatctcagccccaggcctgaagaactgcctaggtgtttagatcctgacctcagaaga
ctagtgccatatcctgacgagaaaagtcgaccggttaaagaaattctcgaattcccaagc
gaagttatttcgccagatttgacgtatcgaaacctcctctacatttatccaaaggaggcg
aatttcagctctagaacaggttctgcgcgaaatatcgcggtgaggattcagcttatgggc
ggtgaacaagaagccgatgccctcacagcaatattcggcagatcatcgtgcccagaaatg
acccacgagtgtttcacttccgtttcctatcacaataaaaatccgaacttctacgacgaa
atgaagattcgacttcccgctgatctaagcgcgaaacatcatttgctatttacgttttat
catatcagttgccagaagaaagtggagcaacctaacgtcgagactgctgtagcgtataca
tggctaccacttttaagagacggacacttgcaatcgggtgaatttagtttacccgcgatg
ctggatccaccaccggcgaattattcgtacatcgcacctgacgttcttctaccaggaacg
agatgggtggatgcccacagaggagtatttactgtgattttagagcccgtatctagcgtt
catccccaagataaatatattgataggttcctttcgctatgtggattcctggaaacgggc
caggtgcctcctcgcatcggagaagcgggaatggaatcggaattgaaatcagctctactg
gaattggcaagagcgtcgcactcagctcttgtacgatcgctacctcaattattggatcaa
ttaatatcgctattagtacgaccgccaacgctgccttctcagcccctaaacatagcagct
actgtgttcgaggctataggtcttttagtccgaaatatcactaatcttcccgacggtcaa
ttggacgctcacggaagacacgctcttttggcgacgtacgtcgcataccagtgttcttta
ccgcaaatgactcaagcacctggcatcgttcgagcccaaagcaaccctgacctaccacta
gaagatcttgaaatggagatccattccagaggactggaccgaacagcctcaatgcggcag
gaatcgccgtccataaacagtcaacccaccagaagacttttacacgaggaattagctttg
cactgggtcgtttctacgggacaggcgagggaattggctgtgacctattcgtggttcttt
ttggaattgatctatcgctcaatggttgtgacgttagcggaaatgggaatgctggaagtt
ccgcggaaatctcgattctcgccgcaattctgtgacgacgtggccacgcttaccgctgcg
ctgacctcggaagtgatctcacgttgcggaaaggatactagagtacctaacaatttgata
tttagcctaggcaacttcctctctgatctgttatcagtaatggacagaggattcgttttg
tccttaattcgtgctgcctgttgctccctgtctgacgcatcaatgcatatacctgactca
gccgcgctttacgcattgaaattggatctcgtgcgaacggtgtgctcgcacgaacattac
gtggctctcaacttgccatttggtaccggatacacttcgggatcggcgccagcttcaccc
agtccatcgactggtagctctggcagtttgatatctactttggtgcccggagatcgagcc
aggttctccgaactcagccaagagtttcgacaacaacatttcttagtaggcatcgtttta
tctgatttatcgaacacgttagagataccgaatcctatgcttcaaaataaagccatcgga
agcatccgacatttaatggcgtgccatgacgtagattcgagatacacggacccctctgcg
aaagccagagtcgctgcattatatctaccacttttgaatattataatggacgctctgcca
cagctctatcattgggattcaaaggataaaagcgtgtatcccgacgaatctgggtccatc
acacaatccgtagcactagccatagcaggcggagtttctgcggaaacggcaggggctcaa
tgcagagtttctttgagctctgaagctacaagacaccttttaatgtgcgttctatgggta
ttgaaaggattggaacaatctgcattggctcagtggtgcgcggagctcagttctaggcgt
attctgtgccttcttcaagttcttaacatcgctactgccgcgtttgagtacaagggtaaa
aaagcattgaagagactgccgccgcaggctgcggctactagtgatatccgatctagatta
gaagacgtgattctcggtcaaggaagcgccagaagcgagatgatgttgcgaagaaaggag
agaatgagcggggataaacttcggtggcgcaaagatcaaatgccttatagatcctgcgag
caatcggaagcgagagcagtggaacaagatgctcatatagaaggtgccttagcagctgaa
gcctcactggtagtcctcgatgctttagaaactgtggttcaagccgatggaggcggaggt
gcggttgtaggagcggtattgaaagttcttttgagagcgttagccaggaatcagagcacg
tccgtgttgcaacacatgttcaatactcagcgagctttagtgtttaagtaccatagcgca
cttttcgacgaagagagcgagagatgcggtgatttgtgcttaacgctgctaaccagatgc
agttctcccttgagtgctgttcgcagccatgctgctgccagtctttatttactcatgaga
cagaatttcgaaattggcaataactttgcaagagtaaaaatgcaagtcacgacatccctg
tccgctctcgttggaagagggagagcacccagcgaaggagcacttaggagagcattaaaa
acagtattggtgtacgctgaacgggatactgaactggcagacacgagcttcccagaacaa
gtaaaagatctcttgttcaatctacacatgatactctctgataccgttaagatgaaagaa
ttccaagaggatccagaaatgcttttggatctcatgtacagaattgccaaaggataccaa
ggctcaccggaccttagactcacgtggctggcaaacatggcacagcaacacatggagaga
aagaatcacacggaagcagctatgtgtttggttcatagcgcggctttagtagcagaatat
ctgcaccttctggagcctgggggtggaggacgacctgtgggagctgttgccttggctcct
gttacaccaaacgctttagaagagagtgcagtgggtgatgacgtgctagcaagaagagaa
gaaggtctctgtctggggccagatttttcagaaagcggtctagctggtttattggaacat
gctgccagctctttccatgcagctggcatgtacgaagcgatacctgacgtctacagagtt
ctgttacccattgcagaagcagcacatgattataagaaactagctaatattcacggtaaa
cttcatgaagcatacacaagagtggaacagctagcagggaaacgagtgttcgggacgtat
ttcagagttggattttacggaagtcgtttcggtgatctcgcgggcgaggaatttgtttac
aaagaaccgactttgaccaagttaccagagatattctcgaggcttgagaatttctacgct
gagagatttggcgcggagaacattgtgataatcaaggattcgaatcctgtagatcctagc
aaattagaaccggacaaagcatacgttcagattacatatgtagaaccgtattttgaacca
cacgaactaaggcataggcccactattttccatcgaaatttcaacatcaaacgatttgtg
tatgcgacgccatttacacctggtgggaaggctcacggagaactgagggagcagtgtaaa
cgcaaaactatactaacagtagcaacacacttcccttatctaaagacgagaattcgagtg
gtcgctaggaagcagatagtcctgagcccaatcgaagttgcaatcgaagacatccaaaag
aaaaccgcagaggttgcagcagcaacagcccaagaaccacctgatgcaaaaatgctgcag
atggtccttcagggttgcattgggacaacagtgaatcaaggccctgcagaagttgcagtc
gtgttcctttctggtttgagagagcaaaacgctcagcctactagattgcagcacaaactg
cgcctgtgttttaaggatttctcaaagaaatgtttagacgccttgaggagaaataagaat
ctaatcgggccggaccaacgagattatcaacgagaattggagagaaactaccaaagatta
acagaaaggctgagtcctctcattgcttggagtggacctccgttaggaagccaacagaat
attccaacgacatcaccacgttggtaa

DBGET integrated database retrieval system