KEGG   Castor canadensis (American beaver): 109675450Help
Entry
109675450         CDS       T04791                                 

Gene name
Wnk3
Definition
(RefSeq) serine/threonine-protein kinase WNK3
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccan01001]
    109675450 (Wnk3)
   01009 Protein phosphatases and associated proteins [BR:ccan01009]
    109675450 (Wnk3)
Enzymes [BR:ccan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109675450 (Wnk3)
Protein kinases [BR:ccan01001]
 Serine/threonine kinases: Other
  Wnk family
   109675450 (Wnk3)
Protein phosphatases and associated proteins [BR:ccan01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109675450 (Wnk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C
Motif
Other DBs
NCBI-GeneID: 109675450
NCBI-ProteinID: XP_020007740
Position
Unknown
AA seq 1621 aa AA seqDB search
MATDSGEPASTEDSEKPDGVSFENTVPQVVATLTVEARLKEKTTFSASGETVERKRFFRK
SVEMTEDDKVSESSPKDERIKAATNISRVDKLPTNVLRGGQEVKYEQCSKTTSESTKDCF
KEKNEKEMEEEAEMKAVATSPSGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQDR
KLTKAEQQRFKEEAEMLKGLQHPNIVRFYDSWESILKGKKCIVLVTELMTSGTLKTYLKR
FKVMKPKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLM
RTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKV
TSGIKPASFNKVTDPEVKEIIEGCIRQNKSERLSIRDLLNHAFFAEDTGLRVELAEEDDY
SNSSLGLRLWVEDPKKLKGKHKDNEAIEFSFNLETDTPEEVAYEMVKSGFFHESDSKAVA
KSIRDRVTLIKKSREKKPTGCLEERRDSQCKSVGNVFPQHQTTALSPAPALHTGAECEET
EVDQHVRQQLLQRKPQQHCSSVRGDNLSETGAGTVIHSDTSSQPNIGYSANQAIVSQMVS
HIPQADINVPGQIYPAQQLVGHCQQISGLQTQPKLTQPQILPVVQGQSSVLPVHVLGPTV
VSQPQVSPLTVQKVSQMKPVSQPVGAEQQAALQKSDLVRSVNQVVAAMKENTNNSDNPSG
NGKQDRIKQRRASCPRPDKGTKFQLTVLQVSTSGDNMVECQLETHNNKMVTFKFDVDGDA
PEDIADYMVEDNFVLENEKEKFVEELRAIVGQAQEILHVHSAAEKAIGVDSVTLESYSNQ
TGSSEQVQINSASTQTSNESAPQSSPVGRWRFCINQTIRNREAQSPPSLQPSTGIVPGLH
LLPSSRNTSNKEIPQDTLFTIENNSCQHALFTSKSEHKDMVDGKISECASIETEQFLYQV
EEDRQIIAPVTSSSNYSATSVCAVSLECEGLISQAGMFIPVYPCHQTASQPDVLMAHPGE
STQVAGNAVPTSALVSEQKPQTLSIQQPTMDPEFISQERETTVNTETSSPKAVIPTQTPG
IEPTTLLPSTVLESDGERPPKMEFADNRIKTLDEKLRNLLYQEHSISSICPESQKDTQSI
DSPFSSSAEDTLSCPMPEVIAISHCGIQDSSAQSPSFQPTGSKILSNVAASQPANISVFK
RDLNVITSVPSELCLHEMSPDASLPADPEAYPAAVSSGGAIHLQTGGGYFGLSFTCPSLK
NPISKKSWTRKLKSWAYRLRQSSSFFKRSKVRQVETEDIRSAIAPDPIPLTREATADTRA
LSRCKAMSGSFQRGRFQVITVPQQQSVKVTSFGIEQRPALKEMTNQSSEDALVFTETAKS
QLVEVEPAGHSPQTSVSSQKSQTLHETFKEDKEIPEQGDNFLSFSRACETSVSSVISEKE
LGETSAMGNRMQSGSELLHIEREVLTARKQPHSNSEFSATLCRNEKTVAKTGSESDQCLP
LHEEQAYAQTQSSLFYSPSSPMSSDDESEIEDEDLKVELQRLREKHIQEVVNLQTQQNKE
LQELYERLRSIKDSKTQSSEIPLPPASPRRPRSFKSKLRSRPQSLTHTDSSIVAKGKSII
K
NT seq 4863 nt NT seq  +upstreamnt  +downstreamnt
atggccactgattcaggggagccagctagcacagaagattctgagaaacctgatggagtt
tcctttgaaaacacagttcctcaggttgttgcaactttgacagtagaagctagactaaag
gaaaaaaccaccttctcagcttctggagaaactgtagaaagaaagagatttttccgaaag
agtgtggagatgacagaagatgacaaagtttccgaatcttcccccaaagatgagagaata
aaggctgcaacaaatatttcaagagtagacaaacttcctacaaatgtcctaagaggtgga
caagaagttaaatatgaacagtgttcaaagacaacctcagaatccacaaaagattgcttc
aaggagaaaaatgaaaaagaaatggaagaagaagcagaaatgaaggcggtggcaacttct
cctagtggcaggttcctgaaatttgacatagagctgggaagaggagcatttaaaactgtc
tataaaggactagacactgaaacgtgggttgaggttgcttggtgtgagctgcaggaccgg
aagttaaccaaagctgaacagcaaaggttcaaggaagaagcagagatgttgaaaggtctc
cagcatcccaatatagttcgattctatgattcctgggagtctatattaaaagggaagaaa
tgtattgtattagtgacagaactaatgacatcaggaaccctaaagacgtacttaaaacga
tttaaagtcatgaaaccaaaggtcttaaggagctggtgcagacaaattttaaaggggttg
cagttcttgcacacgaggactcctcctattattcaccgggatttaaagtgtgacaacatt
ttcatcacaggacccactggatctgtgaagattggtgatctaggactagccactttaatg
cgcacatcatttgctaagagtgtcattggaactcctgagtttatggctccagagatgtat
gaagagcactatgatgaatctgtagatgtctatgcttttggaatgtgtatgctggaaatg
gctacttcagagtatccttattctgagtgccagaatgctgctcaaatataccgtaaagta
accagtggcataaaaccagccagtttcaataaagtcactgatcctgaagtgaaagaaatc
atcgaaggatgcattcgtcaaaacaaatctgaaaggttgtctatcagggacctattaaac
catgcattttttgctgaggatacaggactgagggtggagttagcagaggaagatgattac
tcaaattcatccctgggtctaagactatgggttgaagaccctaaaaaattgaaaggcaaa
cataaagataatgaagctattgaattcagtttcaatttagaaacggatacacctgaggaa
gtagcatatgaaatggtcaaatctggattctttcatgaaagtgattccaaagctgttgct
aaatccattagagaccgggtgaccctgataaaaaaaagtagggagaagaagcctactggc
tgtttggaagaacgcagggattctcagtgcaagtctgtggggaatgtattccctcagcac
cagactacagctttgtcccctgctcctgctctgcacactggggctgaatgtgaagaaact
gaagttgatcaacatgttcgacagcagctcctgcagagaaagccacagcagcactgctcc
tctgttagaggtgacaatttgtctgagacaggagctggaacagttatacattcagatact
tcaagtcagcccaatataggctattccgcaaaccaggcgattgtctcccaaatggtttct
cacatcccacaggctgacataaatgttccagggcaaatttatccagctcagcaactagta
ggacattgccaacaaatttcagggttgcagacacagccaaagctgactcagcctcaaatt
ttgcctgtggttcaaggtcagtcttctgttttgcctgttcatgtccttggacctacagtt
gtttcacagccccaagtttccccattaactgtccagaaggtctcacagatgaagcctgta
tctcaaccagttggagctgaacaacaagcagctcttcaaaaatcagatttagtccgaagc
gtgaatcaagttgtggcagctatgaaggagaataccaataactctgataacccaagtgga
aatggcaaacaggatcggatcaaacagagaagagcttcctgtcctcgaccagacaagggg
actaaatttcagcttactgtccttcaggtgtccacctccggagacaacatggtggagtgt
cagctggagacacacaacaacaagatggtcaccttcaagtttgatgttgatggtgatgca
ccagaggacattgcagactatatggttgaagataactttgtgctggaaaatgagaaagaa
aaatttgtagaagaattgagggctatcgtaggccaagcccaggagatccttcatgtccac
tctgctgcagaaaaagccattggtgttgactctgttaccttagaatcctatagtaaccaa
acaggatcatctgaacaagtacagattaattctgcatccactcaaaccagcaatgaatct
gctcctcagtcgtccccagttggtcggtggcgattttgtatcaatcaaacaataagaaac
cgtgaggctcagtctcctccttctcttcagccttccacgggtatagttcctgggctacat
ctacttcctagttcaagaaacacaagtaataaggaaataccacaggacacactgttcact
atagaaaataattcatgccagcatgcacttttcacctccaaatcagaacacaaggacatg
gttgatggtaagatttctgaatgtgctagtatagaaactgagcagtttctttatcaagtg
gaagaagacaggcagataatagcaccagttactagtagttccaattattctgctacttcg
gtgtgtgcagtttcacttgaatgtgagggactcatcagccaagcaggcatgttcatacct
gtgtatccatgtcaccaaactgccagtcagcctgatgtgcttatggcccatcctggtgaa
tcaactcaggttgctggtaatgctgtaccaacttcggcacttgtatctgagcaaaagcct
caaaccttatcaatacagcagccaactatggatccagagtttatttcccaagaaagagaa
accacagtgaacactgaaacaagttctcctaaggcagtcattcccactcagacccctggc
attgaaccaactacccttctaccctctactgttctcgaatcggatggagaaagacctcca
aaaatggagtttgcagacaacagaattaaaacactggatgaaaaattaagaaacttgctg
tatcaggaacacagcatctctagcatctgtcctgagagtcagaaggatacccaaagcata
gattctccgttttcttcttctgctgaagatacactctcctgtccaatgccagaagtcata
gctatcagtcactgtggaattcaagatagctctgcacaatcccctagtttccaaccaaca
gggtctaagattctgtccaatgtggctgcaagtcagcctgctaatatttcagtatttaaa
agagacctgaatgtgataacttctgtacccagcgaattgtgtttacatgagatgtctcca
gatgcttcacttccagcggatccagaggcctatcctgctgctgtgtcaagcggtggagcc
attcatctgcagacaggaggtggatattttggcctaagctttacttgtcctagtctcaaa
aatcctattagcaagaaatcctggactcgcaaattaaaaagctgggcatacaggctacgg
cagtcatccagctttttcaagagatcaaaagtccgtcaagtggaaacagaagatataaga
tcagcaattgctcctgatcccattcctctgacacgggaggccacagctgatactagggct
ttgagtagatgtaaagcgatgagtggatcatttcagcggggtcggttccaggtgattaca
gttcctcagcaacagtcagtgaaagtgacatcttttggaatagaacagagaccagcatta
aaggaaatgacaaaccaatctagtgaagatgctctagtctttactgaaactgcgaagtct
cagttggtagaggtggaacctgctgggcacagtcctcaaacttcagtttcttctcagaag
tcacaaactcttcatgaaacttttaaagaagataaagaaattcccgaacaaggtgacaac
ttcttatctttcagcagagcttgtgagaccagtgtatcttcagtgatctcggaaaaggaa
ttgggagaaacttcagctatgggaaatagaatgcaatctggatctgaactgttgcatata
gaaagagaggtcctgactgccaggaaacagcctcattctaatagtgaattttcagccact
ctttgtcgtaatgaaaagacagtggcaaaaactggttcagagagtgatcaatgtttacca
ctccatgaagaacaagcttatgctcaaacacagagttcactcttctattctccatcttct
ccaatgagcagtgatgatgagtcagaaatcgaggatgaggacttgaaagtggagcttcaa
agattacgagaaaaacacattcaggaggtggtaaatcttcaaacccagcagaataaagag
ctgcaggagctctatgaacgccttcggtctattaaagatagcaaaactcaatcttcggaa
attcctttgccacctgcgtcaccacgtcgaccaaggtctttcaaaagtaaacttcgcagc
cgtccccagtccttgacacatacagacagcagcatagttgcaaaaggtaaatcaatcata
aaa

DBGET integrated database retrieval system