KEGG   Castor canadensis (American beaver): 109676099Help
Entry
109676099         CDS       T04791                                 

Gene name
Ctso
Definition
(RefSeq) cathepsin O
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04142  Lysosome
ccan04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109676099 (Ctso)
  09143 Cell growth and death
   04210 Apoptosis
    109676099 (Ctso)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ccan01002]
    109676099 (Ctso)
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     109676099 (Ctso)
Peptidases [BR:ccan01002]
 Cysteine Peptidases
  Family C1: papain family
   109676099 (Ctso)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 109676099
NCBI-ProteinID: XP_020008194
Position
Unknown
AA seq 422 aa AA seqDB search
MAPNETHFLLSPFTLEEDAVMAYEAIRRCPGEWNPEIQQHVVREELDIPANKQKPTKKPK
KLQQKQRLPLLRTPIPGWAGGAVTALCPRAAAGRSLGPGRTAGGGMRRGPRAARPALALA
VVLLLCCGAAVPPSWPRSLGREAAAFRESLNRHRYLNSFPRENATAFYGINQFSYLFPED
FRAIYLRSKPSRFPRHPPEVQMSITNVSLPLRFDWRDKHVVTQVRNQQMCGGCWAFSVVG
AVESVCAIHGAPLKDLSVQQVIDCSYNNYGCQGGSPLSALSWLNKTHMQLVTDSEYPFKA
HNGLCRYFSSSQQGVSIKGYSAHDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQ
HHCSRGEPNHAVLITGFDKTGSTPYWIVRNSWGSSWGVNGYAHVKMGANMCGIADSVSAV
FV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaatgaaacccacttcctgctctcgccattcactctggaggaagatgctgtc
atggcatatgaagccatcaggagatgcccaggtgagtggaaccctgaaatccagcagcac
gtggtcagggaagagcttgacattcctgcaaacaaacaaaaacccaccaaaaagccaaag
aaactgcaacagaagcagcgtctccccctgctacgcacccccatccccggctgggcggga
ggggcggtcaccgctctctgcccgcgcgcggccgctgggcggagcctaggacccggaagg
accgcgggcggcgggatgcggcgaggaccgcgggcggcgcgccccgcgctggccctggcc
gtggtgctgctgctgtgctgcggggccgccgttcccccgagctggccgcggagcctcggg
cgcgaggcggccgcctttcgggaaagtctcaacagacatcgatacttgaattcttttcct
cgtgaaaatgccactgctttctatggaataaatcagttttcctatttgtttcctgaagac
tttagagccatttatctaagaagcaaaccttccaggtttcccagacacccacctgaagta
caaatgtccatcaccaatgtgtctttgccactaagatttgactggagggacaagcatgtt
gtgacacaagtgagaaaccagcagatgtgtggagggtgctgggctttcagcgtggtgggt
gcagtggagtctgtgtgtgcaatacatggggcacccttaaaggacctcagtgtgcagcag
gtcatcgactgctcctacaacaactatggctgccagggagggtcacctctcagtgctctg
agctggttaaacaagacacacatgcaactggtgactgactcagagtacccatttaaagct
cataacggcctatgccgttacttctccagctcacagcagggagtttcgatcaaaggttat
tctgcacatgacttcagcgaccaagaagatgaaatggcaaaagcacttcttacctttggc
cctctggtagtgatagtagatgcagtgagctggcaggattacctaggaggcataatccag
caccactgttccaggggagaaccaaaccatgcagttctcataactggctttgataagaca
ggaagtactccatattggatagtgcggaactcatggggaagttcctggggtgtaaatggc
tatgcacatgtcaaaatgggagctaacatgtgtggtattgcagattctgtttctgctgta
tttgtgtga

DBGET integrated database retrieval system