KEGG   Castor canadensis (American beaver): 109676505Help
Entry
109676505         CDS       T04791                                 

Gene name
Tnks
Definition
(RefSeq) tankyrase-1 isoform X1
  KO
K10799  tankyrase [EC:2.4.2.30]
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ccan03032]
    109676505 (Tnks)
   03036 Chromosome and associated proteins [BR:ccan03036]
    109676505 (Tnks)
Enzymes [BR:ccan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     109676505 (Tnks)
DNA replication proteins [BR:ccan03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     109676505 (Tnks)
Chromosome and associated proteins [BR:ccan03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     109676505 (Tnks)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_5 Ank Ank_2 Ank_4 Ank_3 PARP SAM_2 SAM_1
Motif
Other DBs
NCBI-GeneID: 109676505
NCBI-ProteinID: XP_020008471
UniProt: A0A250YMB6
Position
Unknown
AA seq 1326 aa AA seqDB search
MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGTTPASPTAGGLVPFASPR
HGLALPEGDGSRDPPDRPRSPDPVDSTSCCSTTSTICTVTAATVVPATSASSGVGVAPNP
AGGGSNNSPSSSSSPISSSSSSPSSPGSSLAESPEAAGVSTTTLGPGTAGPGTGVPAVSG
ALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGAN
VHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVL
LQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVN
CHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELL
LKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELR
ERLTYEFKGHSLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCAVASLHPKRKQVT
ELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDTLGQTALHRAALA
GHLQTCRLLLSYGSDPSIISLQGFTAAQMGNEAVQQILSESTPIRTSDVDYRLLEASKAG
DLETVKQLCSPQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPL
HNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNR
DGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPL
HLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKHNTCVNATDK
WAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLIDAMPPEAL
PTCFKPQATVVSASLISPASTPSCLSAASSIDNLTGPLAELAVGGASNAGDGAAGTERKE
GEVAGLDMNISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELKEIGINAYGHRHKLIK
GVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGI
FNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDERH
AYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSFL
QFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIMKPEAPSQTAT
AAEQKT
NT seq 3981 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcgcgtcgctctcagcatcatcaccaccatcatcagcaacagctccagccc
gccccaggggcttcggcgcctccgccaccacctcccccccccctcagtcccggcctggcc
ccggggaccaccccagcctcccccacggccggcggcctggtccccttcgcctccccgcgg
cacggcctagcgctgccggagggggatggcagtcgggatccacccgacaggccccgatcc
ccggacccggttgacagtaccagctgttgcagtaccaccagcacaatctgtacggtcact
gccgccaccgtggtcccggcgacttccgcttcatctggcgtcggggtcgctcccaaccca
gccggcggtggcagtaacaattcaccgtcgtcctcttcttccccgatttcctcctcatca
tcttctccatcctcccccggatcgagcttggctgagagtcccgaggcggctggagttagt
accacaactttggggcctgggacggcgggacccgggacaggggtcccagcagtgagcggg
gctctacgcgaactgctggaggcctgtcgtaatggggacgtgtcccgggtaaagaggctg
gtggacgccgcaaacgtaaatgcaaaggacatggctggccggaagtcttctcccttgcac
ttcgcggcaggttttggaagaaaggatgttgtagaacacttactgcagatgggtgctaat
gtccatgctcgtgatgatggaggtctcattccgcttcataatgcctgttcttttggccat
gctgaggttgtgagtctgctactgtgccaaggggcagatccaaatgccagggataactgg
aactatacacctctgcatgaggctgctattaaagggaaaattgatgtctgtattgtgctg
ctgcagcacggagctgatccaaacattcggaacactgatgggaaatcagccctggacttg
gcagatccttcagcaaaagctgtcctcacaggtgaatacaagaaagacgaactcctagaa
gctgctaggagtggtaatgaagaaaaactgatggctttactgactcctctaaatgtgaat
tgccatgcaagtgatgggcgaaagtctactcctttacatctagcagctggctacaacaga
gttcggatagttcagcttcttcttcagcatggtgctgacgttcatgcaaaagacaaaggt
gggcttgtgcctcttcataatgcgtgttcatatggacattatgaagtcacagaacttcta
ctaaagcatggagcttgtgtcaatgccatggatctctggcaatttaccccactacatgag
gctgcttccaagaatcgtgtagaagtttgctccttgttacttagccatggtgctgatccc
acattagtcaactgccatggcaaaagcgctgtggatatggccccaactcctgagcttcgg
gagagactaacttatgaatttaaaggacattctttactacaagcagccagagaagcagac
ctagccaaggttaaaaaaacacttgctttggaaatcattaatttcaaacaaccacagtct
catgaaacagcactgcactgtgctgtggcttccctgcatcccaaacgaaaacaagtgaca
gaattgttacttagaaaaggagcaaatgtcaatgaaaaaaataaagatttcatgactccc
ctgcacgttgccgcggaaagagctcataatgatgtcatggaggttctgcataagcatgga
gcaaagatgaatgcactggatacccttggtcagactgctttgcatagagctgccctagca
ggtcatctgcagacctgccgcctcctgctaagctatggctctgatccctccatcatctcc
ttacaaggcttcacggcagcacagatgggaaatgaagcagtgcagcagattctgagtgag
agcacacctatacgtacttcagatgtggactatcggctcttggaggcatcaaaagctggt
gacttggaaactgtgaagcaactttgcagccctcaaaatgtgaattgcagagatctggag
ggccggcactccacacccttacacttcgcagcaggctataatcgtgtatctgtggtcgag
taccttctgcaccatggtgcagatgtccatgccaaagacaaaggaggcttggtgcccctt
cataatgcctgctcctatggacattacgaggtagctgagcttttagtgagacatggggct
tcggtcaatgtggcggacttatggaaatttacccctctacatgaagcagcagctaaagga
aaatatgaaatttgcaaactccttttaaaacatggagctgatccaactaaaaagaacaga
gatggaaatacgcctctggatttggtcaaagaaggagatacagatattcaggacttactg
agaggggatgctgccttgttggatgctgccaagaaaggctgcctggcaagagtgcagaag
ctctgtacgccagagaatatcaactgcagagacacccagggcagaaactcaactcctctg
cacctagcagcaggctacaataacctggaagtagctgagtatcttctagagcatggagca
gatgttaatgcccaggacaaaggcggtttaattcctcttcataatgcagcatcttatggg
catgtcgacatagcagcattactgataaaacacaacacatgtgtaaatgcaactgataag
tgggcatttactcctcttcatgaagcagcccaaaaaggaaggacacagttgtgtgcccta
ctactagcacatggtgcagatccaactatgaagaaccaagagggtcagacaccgttagat
ctggcaacagctgacgatatccgagctttgctgatagatgccatgccccctgaggcctta
cctacctgctttaaacctcaggcaactgtcgtgagtgcttctctgatctcaccagcatcc
accccctcctgcctctctgctgccagcagcatagataaccttactggccctttagcagag
ttggcagtaggaggggcctccaatgcaggggatggtgcagcgggtacagaaaggaaggaa
ggagaagttgcaggtcttgacatgaatatcagccaattcctaaaaagccttggccttgaa
caccttcgggatatctttgaaacagaacagattacactagatgtgttggctgatatgggt
catgaagagttgaaagagataggcatcaatgcatatggacaccgccacaaattaatcaaa
ggagtagaaagacttttaggcggacaacaaggaactaatccttatttgacttttcactgt
gtaaatcagggaactatattgctagatcttgctccagaagataaagaatatcagtcagta
gaagaagagatgcagagtactattcgagaacacagagatggtggaaatgctggtggcatc
tttaacagatacaatgtcattcgaattcaaaaagttgtcaacaagaagttgagggagcga
ttttgtcacagacaaaaggaagtatctgaagagaatcacaaccatcacaatgagcgcatg
ttatttcacggttctcctttcattaatgccattattcataaagggtttgatgagcgacat
gcctacattggtggaatgtttggagctggaatttattttgctgaaaactcctcaaaaagc
aaccaatatgtttatgggattggaggaggaacaggctgtcccacacacaaagacaggtca
tgttatatatgtcacagacaaatgcttttctgtagagtgacccttggaaaatcctttctg
caattcagcaccatgaaaatggcccatgcccctccaggacatcactcagtcattggtaga
ccaagtgtcaatgggctggcgtatgccgaatatgttatctacagaggagaacaggcatac
ccagaatatctcattacctaccagatcatgaagccagaagctccttcacagactgcaaca
gccgcagagcagaagacctag

DBGET integrated database retrieval system