KEGG   Castor canadensis (American beaver): 109677899Help
Entry
109677899         CDS       T04791                                 

Gene name
Adra1a
Definition
(RefSeq) alpha-1A adrenergic receptor
  KO
K04135  adrenergic receptor alpha-1A
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04020  Calcium signaling pathway
ccan04022  cGMP-PKG signaling pathway
ccan04080  Neuroactive ligand-receptor interaction
ccan04152  AMPK signaling pathway
ccan04261  Adrenergic signaling in cardiomyocytes
ccan04270  Vascular smooth muscle contraction
ccan04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109677899 (Adra1a)
   04022 cGMP-PKG signaling pathway
    109677899 (Adra1a)
   04152 AMPK signaling pathway
    109677899 (Adra1a)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109677899 (Adra1a)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109677899 (Adra1a)
   04270 Vascular smooth muscle contraction
    109677899 (Adra1a)
  09154 Digestive system
   04970 Salivary secretion
    109677899 (Adra1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ccan04030]
    109677899 (Adra1a)
G protein-coupled receptors [BR:ccan04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    109677899 (Adra1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4
Motif
Other DBs
NCBI-GeneID: 109677899
NCBI-ProteinID: XP_020009241
Position
Unknown
AA seq 467 aa AA seqDB search
MVFLSGNASEGSNCTHPPAPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGLRALLCVWAFSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
AQAEGGGGVGSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFP
DFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLKIQCLHRKHPSKHALGYT
LHPPSHALEGQHKDMVRIPVGSGETFYKISKTDGVCEWKFFSSMPHGSARITVSKDQSGC
TTARVRSKSFLQVCCCVGPSTPNLGENHQVPTIKIHTISLSENGEEV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttctctctggaaatgcttctgaaggctccaactgcacccacccgccagcgcca
gtgaacatttccaaagccattttgctcggggtgatcttgggaggccttatcattttcggg
gtgctggggaatatcctggtgatcctttccgtggcctgtcaccggcatctgcactcggtc
actcactactacatcgtcaacctggcggtggccgaccttcttctcacctccacggtgctg
cctttctcagccatcttcgagatcctgggctactgggcctttggcagagttttctgcaac
atctgggcagcggtggacgttctgtgctgcaccgcgtccatcatgggcctttgcatcatc
tcgatcgaccgctacatcggggtgagctacccgctgcgctaccccaccatcgtcacccag
aggagagggctccgggctctgctctgcgtctgggcgttttccctggtcatctccattggg
cccctgtttggctggaggcagccggcccccgaggacgagaccatctgccagatcaacgag
gaaccgggctacgtgctcttctcggctctgggctccttctatgtaccactaaccatcatt
ctggtcatgtactgccgcgtctacgtggtggccaaaagggagagccggggcctcaagtct
ggcctcaagacagacaagtcagactcagagcaagtgacattacgcattcatcggaaaaat
gctcaggcggaaggcggcggcggggtgggcagcgccaagaacaagacgcacttctccgtc
aggctcctcaagttttcccgggagaagaaagcggccaaaacgctgggcatcgtggttggc
tgcttcgtgctctgctggctgccctttttcctagtgatgcccattgggtctttcttccct
gatttcaagccctcagaaacagtttttaaaatagtattttggctcggatacctgaacagc
tgcatcaaccccatcatctacccatgctccagtcaagagttcaaaaaggcctttcagaac
gtcttgaaaatccagtgtctccacagaaagcacccttccaagcatgccctgggctacacc
ctgcacccccccagccacgccctcgagggacagcacaaggacatggtgcgcatccccgtg
ggatctggagaaaccttctataagatctccaagacggatggggtctgtgaatggaagttt
ttctcttccatgccccacggatctgccagaattacagtgtccaaggaccaatccggctgc
accacagccagggtgaggagtaaaagctttttgcaggtctgctgctgtgtggggccctcg
acccccaaccttggagaaaaccaccaagttccaaccattaagatccacaccatctccctc
agtgaaaatggggaggaggtctag

DBGET integrated database retrieval system