KEGG   Castor canadensis (American beaver): 109678621Help
Entry
109678621         CDS       T04791                                 

Definition
(RefSeq) L-amino-acid oxidase-like
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00250  Alanine, aspartate and glutamate metabolism
ccan00270  Cysteine and methionine metabolism
ccan00280  Valine, leucine and isoleucine degradation
ccan00350  Tyrosine metabolism
ccan00360  Phenylalanine metabolism
ccan00380  Tryptophan metabolism
ccan00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccan01100  Metabolic pathways
Module
ccan_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109678621
   00270 Cysteine and methionine metabolism
    109678621
   00280 Valine, leucine and isoleucine degradation
    109678621
   00350 Tyrosine metabolism
    109678621
   00360 Phenylalanine metabolism
    109678621
   00380 Tryptophan metabolism
    109678621
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    109678621
Enzymes [BR:ccan01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     109678621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 DAO FAD_binding_2 Pyr_redox HI0933_like AlaDh_PNT_C Thi4 FAD_oxidored FAD_binding_3 MCRA Lycopene_cycl Pyr_redox_3 GIDA FMO-like Trp_halogenase NAD_binding_7 Shikimate_DH ApbA TrkA_N IlvN NAD_binding_9 Gag_p15 UDPG_MGDP_dh_N 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 109678621
NCBI-ProteinID: XP_020009708
Position
Unknown
AA seq 540 aa AA seqDB search
MSFRAMAKMNGILILGLLLAASNCLSYYEDLAKCFQDPDYESFLITAQDGLHTSPLSKRV
VIVGAGMAGLTAAKTLQDAGHQVTILEASDHVGGRVVTFRNKEEGWYYELGPMRIPKSHR
LVHSYIKKLGLKLNKFIQYDKNTWYLINQRHYRAWEIKENPELLGYSMNPKERGKSAMNL
LHQSITQLKQSLKTFNCSHLMSFYDSYSTKAFLLKEGMLSRGAVQMIGDVMNENAGYQKS
LLESLRIASIFSKSDEFSEITGGFDQLPSALCSSLKPGTIHLGSKVEMVVRDGPEVQVLY
RTGGPTSLLHNLTADYVIISASAKATRLITFQPPLSPDKRDALRSVHYTSATKVVLICDE
RFWERDGIQGGVSITDRPSRYIHYPSHSFPGGKGILLASYTVDDDSLFFTAMKQEQVVDI
VLDDLAAVHQIPKELLQRMCPSSVVKHWSLDPLTIGAFAEFTPYQFVDYSKQLFQPEGQI
YFAGEHTCLPHAWIDTAIKSGIRAARDIQAAVDKEATGGQMPQQKPFTNIQDSFFPKSNP
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagggccatggccaagatgaatggaattctgatcttgggacttctgttggct
gcctccaactgcctttcctactatgaggacctggccaagtgcttccaggacccagattat
gagtccttcctcatcacagcccaggatggactccacacctccccactgtccaagcgtgtg
gttatagtgggagctggcatggcaggcctgacagcagctaagactcttcaggacgctggt
caccaggtaaccatcttggaagccagtgaccatgttggaggtcgagtggtcacattcagg
aacaaggaggaaggctggtactatgaactcgggcccatgagaatccccaaatcccacagg
ctggttcacagctatatcaagaagcttggcctgaagctgaacaagttcatccaatatgat
aaaaacacctggtaccttatcaaccaacgacactatcgtgcctgggagatcaaggaaaac
ccagagctcttgggctattccatgaaccccaaagagaggggcaagagtgctatgaatctc
ttgcaccagtccatcacccagctcaaacaaagtctgaagacattcaactgtagccacctg
atgtctttttatgattcctactccaccaaggctttcctgctaaaagaagggatgctgagc
agaggagcagtgcagatgattggggatgtgatgaacgagaatgctggataccaaaagtcc
ctcctggagtccctgaggattgccagcatcttctccaagagtgacgaattttctgagatc
actggtggctttgaccagctccccagtgccctctgctccagcctgaagcctggtaccatc
catttggggtccaaggtggagatggtagtgagggatgggcctgaagttcaagttttgtac
cgcacaggcgggcccacttcattgctgcacaatctcaccgctgactatgtcatcatctct
gcctcagccaaggctactcgcctcatcaccttccagccacctctgtcccctgacaagaga
gatgccctgcgctcagtgcactacaccagtgctaccaaagtagttttgatctgtgatgag
cgcttctgggaacgggatggcattcagggaggagtctccatcactgaccggccctcccgc
tacatccactaccccagccacagcttcccaggtggcaagggcattctgctggcctcctac
acagtggatgatgattcactcttcttcactgccatgaagcaggagcaggtggtggatatt
gtcctggatgacctggcagcagtgcaccagatacccaaggagttgctgcagcgcatgtgc
ccctcctcagtggtcaaacactggtcattggaccctctcaccattggtgcctttgctgag
ttcacaccctaccaatttgtggactattcaaagcagcttttccagccagagggccaaatc
tactttgctggtgagcatacttgcctgccccatgcctggatcgacactgccattaagtcc
ggcatccgggctgccagggacatccaggctgctgtggacaaggaggccacaggaggacag
atgcctcagcagaagcctttcaccaacatccaagacagtttctttcctaagagcaatccc
tga

DBGET integrated database retrieval system