KEGG   Castor canadensis (American beaver): 109679520
Entry
109679520         CDS       T04791                                 

Gene name
Dck
Definition
(RefSeq) deoxycytidine kinase isoform X1
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00230  Purine metabolism
ccan00240  Pyrimidine metabolism
ccan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109679520 (Dck)
   00240 Pyrimidine metabolism
    109679520 (Dck)
Enzymes [BR:ccan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     109679520 (Dck)
SSDB
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_28 AAA_33
Other DBs
NCBI-GeneID: 109679520
NCBI-ProteinID: XP_020010285
Position
Unknown
AA seq 355 aa
MATPPKRICPSPATSSEGTRIKKVSIEGNIAAGKSTFVNILKKGCEDWKVVPEPVARWCN
VQSTQDEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLASLNGKLKDAE
EPVLFFERSVYSDRYIFASNLYESDCMNETEWTVYQDWHDWMNNQFGQSLELDGIIYLRA
SPEKCLSRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPVLTLDVNE
DFKDKHESLVGKAGPGIEILLPQVLVYRRAPPCLTPGLVCFIYYYYYSRDGLRLASNSWA
EWVLLPQPPKKLGLQVHTTMPDFAELSPLQRTCNSRRFTTSVLKKHIATDNLKDF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggccaccccgcccaagagaatctgcccgtctcccgcgaccagctcggaggggacccgc
atcaagaaagtctccatcgaggggaacatcgctgcaggaaagtcaacatttgtgaacatc
cttaaaaaaggctgtgaggattggaaagtggttcctgaacctgttgccagatggtgcaat
gttcagagtacacaagatgaatttgaggaactgacaacgtcccagaaaagtggtgggaat
gttcttcaaatgatgtatgagaaacccgaacgatggtcttttaccttccaatcatatgcc
tgtctcagtcggatacgagctcagcttgcctctctcaatggcaagctcaaagatgcagag
gaacctgtgttattttttgaacgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgactgcatgaatgaaacagagtggacagtatatcaagactggcatgac
tggatgaataatcaatttggccaaagccttgaattagatggaatcatttatcttcgagct
tctccagagaaatgcctaagtagaatatatttacgaggaagaaatgaagagcaagggatt
cctcttgaatatttagagaaacttcactataaacatgaaagctggctcctgcatagaact
ctgaaaaccaattttgattatctacaagaagtaccggtcttaacattggatgttaatgaa
gactttaaagacaaacatgaaagtctggttggaaaggctggccctggaattgagatcctt
ctccctcaagtgctggtttacagacgtgctccaccttgtctaactccgggacttgtgtgt
tttatttattattattattattcacgagatggtctcaggctggcttcaaactcctgggct
gagtgggtcctcctgcctcagcctcccaagaagctgggactacaggtgcacaccaccatg
cctgactttgcagaactttcgcctttgcaaaggacttgtaattcaagaaggtttacgaca
tcagtgctgaagaaacatatcgccacagacaatttgaaggacttttga

DBGET integrated database retrieval system