KEGG   Castor canadensis (American beaver): 109681562Help
Entry
109681562         CDS       T04791                                 

Definition
(RefSeq) CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase-like isoform X1
  KO
K00781  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00514  Other types of O-glycan biosynthesis
ccan00515  Mannose type O-glycan biosynthesis
ccan00533  Glycosaminoglycan biosynthesis - keratan sulfate
ccan00601  Glycosphingolipid biosynthesis - lacto and neolacto series
ccan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    109681562
   00514 Other types of O-glycan biosynthesis
    109681562
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    109681562
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    109681562
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ccan01003]
    109681562
Enzymes [BR:ccan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     109681562
Glycosyltransferases [BR:ccan01003]
 Terminal extension
  Sialyltransferase
   109681562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBA_3
Motif
Other DBs
NCBI-GeneID: 109681562
NCBI-ProteinID: XP_020011967
Position
Unknown
AA seq 100 aa AA seqDB search
MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEDSNSMILSFDSAGQTLGAEYDRLG
FLLKLDSKLPAELATKYANFSEGACKPGYASALMTAIFPR
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgggactcctggtgtttgtgcgcaatctgctgctagccctctgcctctttctggtactg
ggatttttatattattctgcctggaagctacatttactccagtgggaagactccaattca
atgattctttcctttgactccgctggacaaacactaggcgcagagtatgatcggttgggt
ttcctcctgaagctggactctaaactgcctgctgagttagccaccaagtacgcaaacttt
tcagagggagcctgcaagcctggatatgcttcagccctgatgactgccatctttccccgg
taa

DBGET integrated database retrieval system