KEGG   Castor canadensis (American beaver): 109681827Help
Entry
109681827         CDS       T04791                                 

Gene name
Minpp1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00010  Glycolysis / Gluconeogenesis
ccan00562  Inositol phosphate metabolism
ccan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109681827 (Minpp1)
   00562 Inositol phosphate metabolism
    109681827 (Minpp1)
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     109681827 (Minpp1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     109681827 (Minpp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708 SID
Motif
Other DBs
NCBI-GeneID: 109681827
NCBI-ProteinID: XP_020012305
UniProt: A0A250YIT9
Position
Unknown
AA seq 482 aa AA seqDB search
MLCGPPGLLRASVAPAAALAAALLSSVARCALLEPSDPVASALSPYFGTKTRYEDVNPGL
LLDPEAPRRDPQLLDGACTPVQLVALIRHGTRYPTAKQIRKLRQLHGLLQARAPGHGGDS
DLGAVLADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENCGRLQLVTSSKH
RCVDSGAAFLQGLWQHYHPGLSPPDVADMECGPPRINDKLMRFFDHCEKFLTEVERNVTA
LHHVEAFKAGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIRGVKSPWCDIF
DIDDAKVLEYLNDLKQYWKRGYGYAINSRSSCSLFQDIFQHLDKAVEQKQRSQPVSSPVI
LQFGHAETLLPLLSLMGYFKDKEPLTAYNYEEQVYRKFRSGHIVPYASNLIFVLYHCENA
KTPKEEFQVQMLLNEKVLPLAYSQETVSLYEDLKNHYKDILQSCQTSEECELPKRNSTFD
EL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgctttgcggtcccccgggcctgctcagggcctccgtagcgcccgccgcggccctggcg
gcggcgctgctctcgtcggtcgcgcgctgcgctctcctagagcccagcgacccggtggcc
tcggcgctcagcccctacttcggcaccaagactcgctacgaagatgtcaaccccgggcta
ctgttggatcccgaggcaccgcggcgggacccccagctgctggacggcgcctgcaccccg
gttcagctggtcgccctcattcgccacggcacccgctacccgacggccaagcagatccgc
aagctgaggcagctgcacgggctgctgcaggcccgcgcgcccgggcatggcggcgacagc
gacctgggcgccgtgctggccgactggccgctgtggtacgcggactggatggacgggcag
ctggtggagaagggacggcaggacatgcgacagctggcgctccgtctggcctcgctcttc
cccgccctcttcagccgggagaattgtggccgcctgcagctggtcaccagctctaagcac
cgctgcgtggacagcggtgccgccttcctgcaggggctgtggcagcactaccacccggga
ttgtcgccgcctgacgtcgcagatatggagtgtggacctccaagaatcaatgataaacta
atgaggttctttgatcattgtgagaaatttttaactgaagtggaaaggaatgttacagct
cttcatcatgtagaggccttcaaagctggaccagaaatgcagaacattttaaaaaaagtt
gcagctactttacaagtgccagtaaatgatttaaatgcagatttaattcaggtggcattt
ttcacctgttcatttgacctggcaattagaggtgttaaatctccttggtgtgatattttt
gacatagatgatgcaaaggtattagaatatttaaatgatctgaaacaatactggaaaaga
ggttatggatatgccattaatagtcgatccagctgctccctgtttcaggatatctttcag
cacttggacaaagcagttgaacagaagcaaaggtctcagccagtttcttctccagtcatt
ctccagtttggtcatgcagagactcttcttccactgctttctctcatgggctacttcaaa
gacaaagagcccctaacagcttataattatgaggaacaagtctatcggaagttccgaagt
ggtcacatcgtaccttatgcctcaaacctaatatttgtgctttatcattgtgaaaatgcg
aagactcctaaagaagagttccaagtacagatgctattgaatgaaaaggttttacccttg
gcttactcacaggaaactgtctctttgtatgaggatctgaagaaccactacaaggacatc
cttcagagttgtcaaaccagtgaagaatgtgaattaccaaagaggaacagcacattcgat
gagctttga

DBGET integrated database retrieval system