KEGG   Castor canadensis (American beaver): 109683227Help
Entry
109683227         CDS       T04791                                 

Definition
(RefSeq) threonine synthase-like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109683227
Enzymes [BR:ccan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     109683227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4715 AMP_N Suc_Fer-like PALP
Motif
Other DBs
NCBI-GeneID: 109683227
NCBI-ProteinID: XP_020014513
Position
Unknown
AA seq 135 aa AA seqDB search
MGLPIHLVVAVNHNDIIHRTVQSGDFSLSEAVKPTLASAMDIQVPYNMERIFWLLSGSNS
QETKALMEQFERTQSLHLPKELHSKLSEAVTSESVSDDAITRTMARCWDENKYLLCPHSA
VAVSYHYQQTDKQQP
NT seq 407 nt NT seq  +upstreamnt  +downstreamnt
atggggctgcccatccacctggtcgtggcagtgaaccacaatgacatcatccacaggact
gtccagagtggagacttctctctgtctgaagctgtcaaaccaaccttggcatcagctatg
gacattcaggtaccatacaacatggagagaatcttctggctgctttctggctccaacagc
caggagacaaaagccctcatggagcagtttgaaagaacccaaagtctgcatctacccaag
gaactgcacagcaagctttcagaggcagtaacatctgagtcagtatcagatgacgccatc
acgcggaccatggcccgctgctgggatgagaacaagtacctgttgtgtcctcactctgct
gtggctgtgagttaccattaccagcagacagacaagcagcagcccag

DBGET integrated database retrieval system