KEGG   Castor canadensis (American beaver): 109683718Help
Entry
109683718         CDS       T04791                                 

Gene name
Fkbp1b
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP1B isoform X1
  KO
K09568  FK506-binding protein 1 [EC:5.2.1.8]
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ccan03110]
    109683718 (Fkbp1b)
Enzymes [BR:ccan01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     109683718 (Fkbp1b)
Chaperones and folding catalysts [BR:ccan03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    109683718 (Fkbp1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 109683718
NCBI-ProteinID: XP_020015305
Position
Unknown
AA seq 108 aa AA seqDB search
MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGF
EEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtggagatcgagaccatatccccaggagacggaagaacattccccaagaagggc
cagacatgtgtggtacactacacaggaatgctccaaaacgggaagaaatttgactcatcc
agagacagaaacaaacctttcaagtttagaattggcaaacaggaagtcatcaaaggtttt
gaagagggtgctgctcagatgagcttggggcagagggcgaagctgacctgcacccctgat
gtggcatatggagccacaggccaccctggtgtcatccctcccaatgccaccctcatcttt
gacgtggagctgctcaacttagaatga

DBGET integrated database retrieval system