KEGG   Castor canadensis (American beaver): 109683725Help
Entry
109683725         CDS       T04791                                 

Gene name
Cdk15
Definition
(RefSeq) LOW QUALITY PROTEIN: cyclin-dependent kinase 15
  KO
K15594  cyclin-dependent kinase 15 [EC:2.7.11.22]
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccan01001]
    109683725 (Cdk15)
Enzymes [BR:ccan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109683725 (Cdk15)
Protein kinases [BR:ccan01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109683725 (Cdk15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 109683725
NCBI-ProteinID: XP_020015314
Position
Unknown
AA seq 435 aa AA seqDB search
MGQELCAKRLQPGCGCYHRSEGGEAPSCWRSRPVTTEAALELTDLKEASRSMTSFHPRGL
RAAGAGKLESTRPRSNSDSFQEEDVRQGSPWRKSLPFGAPSSYLNLEKLGEGSYATVYKG
ISRINGQLVALKVISMNAEEGVPFTAIREASLLKVXKHANILLLHDIVHTKETLTFVFEY
MHSDLAQYIHQHPGGLHPHNVRLFMFQLLRGLAYIHHQHVLHRDLKPQNLLISHLGELKL
ADFGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQPLF
PGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEWFLLPKPASLQIVWNRLGGVPEA
EDLASQMLKGFPRDRVSAQEALVHGYFSALPSQLYHLPDEESLFTVSGVRLKPEMCDLLA
TYRKGHHPTRFSKCW
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaagagctgtgtgcaaagaggctgcagcctggatgcggctgctatcaccgttca
gagggaggcgaggcacccagctgttggaggagtcggcctgtgaccacggaggctgcattg
gagctaacagacctaaaagaagcatcacgttccatgacttcatttcaccccaggggactt
cgggctgccggtgctgggaagttggagagtacaaggccacggagtaacagcgattctttt
caggaggaggatgtgcggcagggttccccgtggaggaagagcctcccttttggggcaccc
tcgtcttacttgaacttggaaaagctgggtgaaggttcttatgctactgtttacaaggga
attagcaggatcaatggacaattagtggctttaaaagtcatcagcatgaatgcagaggaa
ggagtcccattcacagctatcagggaagcttctctcctgaaggtttgaaagcacgccaac
atattgctcctgcatgacatagttcacaccaaagagacgttgacatttgtttttgaatac
atgcactcagacctggctcagtacatacatcagcatccgggagggcttcatcctcacaac
gtcaggcttttcatgtttcaacttttgcggggcctggcatacatccaccaccaacacgtt
cttcacagggatctgaaacctcagaacttgctcatcagtcacctgggagagctcaaactg
gctgattttggtcttgctcgggcaaagtccattcctagccagacatactcttcagaagtt
gtgaccctctggtaccggcctcctgatgctttgctgggagccactgaatattcctctgag
ctggacatatggggtgcaggctgcatctttattgaaatgttccagggtcaacctttgttt
cctggggtttccaacatccttgaacagctggaaaagatctgggaggtgttgggagttcct
acagaggatacctggcctggagtctccaagctgccaaactacaatccagaatggttcctg
ctgcctaagcctgcaagtcttcagattgtctggaacaggctgggcggggttcctgaagct
gaagacctggcctcccaaatgctgaaaggtttccctagggaccgtgtctctgcccaggaa
gcactggttcatggttatttcagtgccctgccttcccaactgtaccaccttcctgacgag
gagtctttgtttacagtttcaggagtgaggctaaagccagaaatgtgtgaccttttggcc
acctacaggaagggtcaccacccaacccggtttagcaaatgctggtaa

DBGET integrated database retrieval system