KEGG   Castor canadensis (American beaver): 109683908Help
Entry
109683908         CDS       T04791                                 

Gene name
Cpt1c
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, brain isoform
  KO
K19524  carnitine O-palmitoyltransferase 1, brain isoform [EC:2.3.1.21]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00071  Fatty acid degradation
ccan01212  Fatty acid metabolism
ccan03320  PPAR signaling pathway
ccan04152  AMPK signaling pathway
ccan04714  Thermogenesis
ccan04920  Adipocytokine signaling pathway
ccan04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109683908 (Cpt1c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    109683908 (Cpt1c)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    109683908 (Cpt1c)
   04920 Adipocytokine signaling pathway
    109683908 (Cpt1c)
   03320 PPAR signaling pathway
    109683908 (Cpt1c)
  09159 Environmental adaptation
   04714 Thermogenesis
    109683908 (Cpt1c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ccan03029]
    109683908 (Cpt1c)
Enzymes [BR:ccan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     109683908 (Cpt1c)
Mitochondrial biogenesis [BR:ccan03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    109683908 (Cpt1c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 109683908
NCBI-ProteinID: XP_020015570
Position
Unknown
AA seq 807 aa AA seqDB search
MGRTVSTSGRAPGAMAEAHQAVSFLSSLTSDGAEVELSSPVVQEICLSGLRSWKRHLWRF
WNDFLTGVFPASPLSWLFLFSAIQLAWFLQLDPSLGLMEKIKELLPDWGGQHHRLRGVLA
AALFASCLWGALIFTLHVALRLLLSYHGWLLEPHGAMSSPTKTWLALVRIFSGRHPMLFS
YQRCLPRQPVPSVQDTVRKYLESVRPVLSDEDFDWTALLARDFLKLQASLLQWYLCLKSW
WASNYVSDWWEEFVYLRSRNSLMVNSNYYLMDFLYVTPTPLQAARAGNAVHALLLYRQRL
SRQEMPPTMLMGMRPLCSAQYEKIFNTTRVPGVERDSICHLRDSWHVAVFHRGRFFRVGT
HSPNGLLSPRALEQQFQHILDDPSPACPHEEHLAALTAAPRGMWAQVRESVKTRAAAALE
AVEGAAFFVSLDSEPGGLTREDPAVSLDAYAHVLLAGRGHDRWFDKSFTLIVFSNGKLGL
SVEHSWADCPISGHMWEFTLATECFQLGYSADGHCKGQPDPTLPQPQRLQWDLPDQIHPS
ISLALRGAKTLSANIDCHVFPFSHFGKSFIRRCHLPSDSFIQMALQLAHFRDRGQFCLTY
ESAMTRLFLEGRTETVRSCTREACNFVKAMEDKEKTDPQCLALFRVAVDKHQALLKAAMS
GQGVDRHLFALYIASRFLHVQSPFLAQVHSEQWQLSTSQIPVQQMHLFDVHNYPDYVSSG
GGFGPADDNGYGVSYIFMGDDMVTFHIASKKSSTKTDSHRLGQHIEDALLDVAALFQAGQ
RLKRRFRGARGEDLRHRCGFLSSKIAD
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atggggaggacagtgtcaacgtccggcagggctcctggtgccatggctgaggcacaccag
gctgtgagcttcctgtcctccctaacgtctgatggggcagaagttgagctcagcagcccc
gtggtgcaggagatctgcctgtctggccttcggtcttggaaaaggcacctttggcgtttc
tggaatgactttctcactggtgtgttccctgctagtcccctcagctggctcttcctcttc
agtgcaatccagcttgcctggttcctccagctagatccttccctaggattgatggagaag
attaaagaattactgccagactggggtggccagcaccaccggctccggggggtcctggca
gctgcgctgtttgcctcgtgtttatggggagccctgatcttcacgctgcatgtggccctg
aggctgcttctgtcctaccacggctggctgcttgagccccatggagccatgtcctcgccc
accaagacctggctggctttggtccgcatcttctccggccgccacccgatgctcttcagt
taccagcgctgcctgccgcgccaacccgtgccctcggtgcaggacaccgtgcgcaagtac
ctggagtctgtccgtcctgtcctctccgacgaggacttcgactggacggcactgctggca
cgggacttcctgaagctgcaggcgtcgctgctgcagtggtacctgtgcctcaagtcctgg
tgggcgtccaattacgtcagtgactggtgggaagaatttgtgtacctgcggtctcgcaac
tcgctaatggtgaacagcaactattacttgatggacttcctatatgtcacacccacgccg
ctgcaggcagctcgcgctgggaacgcagtccacgccctgctcctataccgccagcgcctg
agccgccaggagatgcctccgactatgctgatggggatgcgccccctgtgctctgcccag
tatgagaaaatattcaacaccacgcgggtgccaggggttgagagagactccatctgccac
cttcgcgacagctggcacgtggctgtcttccaccggggccgatttttccgcgtggggacc
cattccccaaatggcctgttgtccccgagggccctggagcagcagttccagcacatcctg
gatgacccctcacctgcgtgtccccacgaggagcatctggctgccctgacagccgctccc
aggggtatgtgggcccaagtgcgggagtcggtgaagacccgggctgccgctgccctggag
gccgtggaaggggcggccttctttgtgtcgctggattccgagcctgggggactcaccagg
gaggaccccgcagtgtcactggacgcctatgcacatgtccttctggctggccggggccat
gaccgctggttcgacaaatccttcaccctcatcgtcttctccaacgggaaactgggactc
agtgtggagcactcgtgggctgactgccccatctcaggacacatgtgggagttcactctg
gccacagaatgttttcagctgggctactcggctgatggccactgtaaggggcagcctgac
cccacactgccccaaccccagcggctacagtgggaccttccagaccagatccatccctcc
atctccctagccctgagaggagccaagaccttgtctgcaaacatcgactgccatgtcttc
cccttctcccactttggcaagagcttcatcagacgctgccacctcccctcagacagcttc
atccagatggccctgcagctcgcccacttccgggacaggggtcagttctgcctgacttat
gaatcagccatgactcgcttgttcctggaaggccggacggaaacagtgcggtcttgcaca
agggaggcctgcaactttgtgaaagccatggaggacaaggagaagacagacccgcagtgc
ctcgctctgttccgcgtggcagtggacaaacaccaggctctgctcaaggcagcgatgagc
gggcagggggtggaccgccacctctttgcgctctacatcgcgtcccggttcctccacgtg
cagtcacccttcctggctcaggttcactccgagcagtggcaactgtccaccagccagatc
cctgtccagcaaatgcacctgtttgacgtccacaattacccggattatgtttcctcgggt
ggtggattcgggcctgccgatgacaatggctatggtgtgtcatatatcttcatgggggat
gacatggtcaccttccacattgccagcaagaagtcaagcacaaaaacagattcccaccgg
ctggggcagcatattgaggatgccctgctggatgtggccgccctgttccaggcagggcag
cgtctcaagcgtcgattcagaggggctaggggggaggacttgcggcacagatgtggattt
ctctccagtaaaatagcagactga

DBGET integrated database retrieval system