KEGG   Castor canadensis (American beaver): 109684717
Entry
109684717         CDS       T04791                                 

Gene name
Erap1
Definition
(RefSeq) LOW QUALITY PROTEIN: endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ccan01002]
    109684717 (Erap1)
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109684717 (Erap1)
Peptidases and inhibitors [BR:ccan01002]
 Metallo peptidases
  Family M1
   109684717 (Erap1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF1570
Other DBs
NCBI-GeneID: 109684717
NCBI-ProteinID: XP_020016826
Position
Unknown
AA seq 942 aa
MVPLPLRWPLASMSFLLFSLLILLAVSTPSWCQGTEATSPKASNGAPFPWNKLRLPEHVI
PVHYDLTIHANLSTLTLWGNTEIEVTTSQPTSTIILHSHLLQISRATLRKGAGEKLTEEP
LRVLEYPPHEQVALLAPEPLLVGVPYTVVINYAGNLSEHFHGFYKSTYRTKEGEVRVLAS
TQFEPTAARMAFPCFDEPALKASFSVKIRREPRHLAISNMPLVKSVTIAEGLIEDHFDVT
VKMSTYLVAFIISDFKSVSKLTKSGVKVSVYAVPDKIYQADYALDAAVTLLEFYEDYFSI
PYPLPKQDLAAIPDFQXGAMENWGLTTYRESSLLFDAEKSSASSKLGITMTVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEDYFLGKCFNAMEVDALNSSHPV
STPVENPAQIREMFDDVSYEKGACILHMLRDYLTADTFKSGIVHYLHKYSYKNTKNEDLW
NSMATICPTDSTQGTDGFCSRSQHLSSTSHWHQEGVDVKTMMNTWTLQKGFPLITITVRG
RNVHMKQEHYMKGSDNAPETGHLWHVPLTFITSKSDSVQRFLLKTKTDVLILPEAVEWIK
FNVGMNGYYIVHYEDDGWDSLTGLLKGTHTAISSNDRASLINNAFQLVSIGKLSIEKALD
LILYLKQETEIMPVFQGLNELIPMYKLMEKREMNEVETQFKAFLLRLLRDLIDKQTWADQ
GSVSERVLRSQLLLLACVRKYQPCVQKAEDYFKKWKESNGNMSLPVDVTLAVFSVGAQNT
EGWDFLYSKYQSSLSSTEKSQIEFALCTSQNKEKLQWLLDQSFKGDIIKTQEFPYILTLI
GKNPVGYPLAWQFLKENWNKLVQKFELGSATIAHMVTGTTNQFSTQTRLEEVKGFFSSLK
ENGSQLRCVQQTIETIEENIRWMDKNFDKIRLWLQSEKLALL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atggtgcctctgcccctcagatggccacttgcaagcatgtcgtttctacttttctcacta
ctgattctcttagctgtatcaaccccttcatggtgtcagggcactgaagctacatctcca
aaagctagtaatggggcaccatttccttggaataaattgagacttcctgagcatgtcatc
ccagttcactatgacctcacgatccatgcaaacctcagcacactgactttgtggggaaac
acagaaatagaagtcaccaccagccagcctactagtaccatcatcttgcatagtcacctc
ctacaaatatctagggccaccctcaggaaaggagctggagagaagctgacagaagaacca
ctgagggtcctggaatatcccccccatgaacaagtcgcacttctggctccggagccactt
cttgttggggtcccatacacagttgtcatcaactacgctggcaatctctctgagcacttc
cacggattttataaaagcacctacagaaccaaagaaggagaagtgagggtacttgcatca
acacagtttgaaccgactgcagctcgaatggcttttccctgctttgatgaacctgctttg
aaagcgagtttctcagttaaaatcagaagggagccaaggcacctggccatctccaacatg
ccgttggtgaaatctgtcactattgctgaaggactcattgaagaccattttgatgtcact
gtgaagatgagcacctatttggtggccttcattatttcagattttaagtctgtcagcaag
ctgaccaagagtggagtcaaggtttctgtgtatgctgtgccagacaagatatatcaagca
gattatgccctggatgccgcagtaacccttctggaattttatgaggattatttcagcatt
ccataccctttacccaagcaagatcttgctgcaattcctgactttcagntcggagctatg
gaaaactggggcctgaccacatacagggaatcctctctgttgtttgatgcagaaaagtct
tcagcatccagcaaacttggcatcacaatgactgtgtcccacgaacttgcacaccagtgg
ttcgggaaccttgtcactatggaatggtggaatgacctttggcttaatgagggatttgcc
aagtttatggagtttgtgtctgtcagtgtgacccatccggaactgaaagttgaagattat
ttccttggcaagtgttttaatgcgatggaggttgatgcattaaattcctcacaccctgtg
tccacacctgtggagaatcctgctcagattcgagagatgtttgatgatgtttcttatgaa
aagggagcttgtattctgcatatgttaagagattatctgactgctgatacatttaaaagt
ggaattgtgcactatctccataagtatagctataaaaacacaaaaaatgaggacctctgg
aatagtatggcaactatttgtcccacagatagtacacaagggacggatggcttttgctct
agaagtcaacacttgtcttcaacctcacactggcatcaggaaggtgtggatgtgaaaacc
atgatgaacacctggacgctgcagaagggctttcccctgatcaccatcacagtaagaggg
aggaacgtacacatgaagcaagaacactacatgaaagggtctgacaacgccccagaaact
gggcacctatggcatgttccattgacattcattaccagcaaatcagactctgtccagaga
tttttgctgaagacaaagacagatgtgctcatccttcctgaagcagtggaatggatcaaa
tttaatgtgggaatgaatggctattacatcgtgcattatgaggatgatggatgggattct
ttgactggccttttgaaaggaacacatacagcaatcagcagtaatgatcgggcgagtctc
attaacaatgcatttcagcttgtcagcattggaaagctatcaattgaaaaagccttggat
ttaatcctgtacttgaaacaggaaactgaaattatgcctgtgtttcaaggactgaatgag
ctgatacctatgtataaattaatggagaagagagagatgaatgaagtagaaactcaattc
aaggccttcctcctcaggctgctgagggacctcattgataagcagacatgggcggaccaa
ggctcagtctcagagagagtgctgcggagccagctcctccttcttgcctgtgtgcgcaag
tatcagccctgtgtgcagaaggcagaagactatttcaaaaagtggaaggaatccaatgga
aatatgagcctgcctgttgatgtgaccttggcagtattttctgtgggggcccagaacact
gaaggctgggattttctttatagtaaatatcagtcttctttgtccagtaccgagaaaagc
caaattgaatttgccctctgtacgagccaaaataaggaaaagcttcaatggctactagat
caaagttttaagggagatataataaaaactcaagagtttccatatattcttacactcatt
ggcaaaaacccagtgggatatcctttggcctggcagtttctgaaggaaaattggaataaa
cttgtacaaaaatttgaacttggctcagctaccatagcccacatggtaacgggaacaaca
aatcaattctccacccaaacacgtcttgaagaggtaaaaggattcttcagctctttgaaa
gaaaatggttctcagctccgctgtgttcaacaaacaattgaaaccattgaagaaaacata
cgttggatggataagaattttgataaaatcagactgtggctgcaaagtgaaaagcttgca
ctgctgtaa

DBGET integrated database retrieval system