KEGG   Castor canadensis (American beaver): 109685485Help
Entry
109685485         CDS       T04791                                 

Definition
(RefSeq) selenide, water dikinase 2-like
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00450  Selenocompound metabolism
ccan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    109685485
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ccan03016]
    109685485
Enzymes [BR:ccan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     109685485
Transfer RNA biogenesis [BR:ccan03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    109685485
 Prokaryotic Type
    109685485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-GeneID: 109685485
NCBI-ProteinID: XP_020017924
Position
Unknown
AA seq 524 aa AA seqDB search
MLYMCRRSLQPASCLYSCSRGHLGAGRGHHGAAGHSLILGECVAKRQPVFLARSCAYSKR
WQEAWVSPAEANQRPSPLLSPPSLTAGAIAEGTSEIATEGSSCPAALSLGLNFCSYWPFQ
PQALGLSPSWRLTVFSGMKGUSCKVPQEALLKLLEGLTQPKVRPPQGLDQKEVAQQASLS
ALAGPSPTYPSLGIGLDSCIIPLRHRGLSLVQTTDFSYPLVDDPYMMGRIACANVLSNLY
AMGITDCDNMLMLLSVSQNMSKKEREKITSLMIKGFRDAAEEGGTVVTGGQTVVNPWIII
GGVDTAVRQPNELITPDSAVVGDMLLLTKPLGTQVALNAHQWLDSPEKWNKIKMVVSREE
VVVAYQEAMFSMATLNRTAAELMHTFNAHAATDTTGFGILRHCQNLVKQQRNEVSFVIHN
LPIIVKMAVISKASGQFGLLQGTSAETSGGLLIYLPREQAACFCSAIKSSKYGEGGQAWI
IGIVEKGNRTAQIIDIPWVIEVQPRGADVPTALVSHKFSASEPS
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacatgtgcagacgcagcctgcagccagcgtcgtgcttgtactcgtgctcacgt
ggtcacctaggggcgggtaggggccatcatggggctgcagggcacagcctcatccttggt
gagtgtgtggccaagcggcagcctgtgttcctagctcgctcttgcgcttactctaagcgc
tggcaggaggcctgggtctcaccagcagaagcgaatcaaaggccctctcctcttctctcc
cctccctccctgactgcaggagcaatagcagaaggcacctcagagatagctacagaaggc
tcctcctgcccagctgctttgtctctaggtctcaacttctgcagctactggcccttccag
ccacaggctttggggctcagccccagctggcgactgacagttttctcaggcatgaagggc
tgaagctgcaaggtcccccaggaggcactgctcaaactcctggagggactaacgcaacca
aaagtgcggcctccacagggcctagaccaaaaagaggtagcccaacaggccagcctgtca
gctctggctggtcctagcccaacctatccatccctgggcattgggctggattcctgcatc
atcccactgaggcacaggggcctgtcactggtgcagacaactgacttctcttacccactg
gtagatgatccctacatgatggggcgcatagcttgtgccaatgtgttgagtaacctctat
gccatgggcattactgactgtgacaacatgttaatgttactcagcgtcagccagaacatg
agcaagaaggaacgagaaaagataacatcgctcatgatcaaaggctttcgggatgctgct
gaggaaggagggactgtagtgactggaggacagacagtggtcaacccttggattatcatt
ggtggagttgacactgcagtacgtcagccaaatgaacttataacacctgacagtgcagtt
gtaggagatatgctcttgttaaccaaacccttaggaacccaagttgctctaaatgctcac
caatggttagatagtcctgagaaatggaataagataaagatggtggtctctagagaagag
gtagtggtggcctatcaggaagctatgttcagtatggctaccctaaacagaactgctgct
gaattaatgcacacatttaatgcccatgcagccacagatacaacgggctttggcattcta
aggcattgtcagaaccttgtaaaacaacaaagaaatgaggtatcctttgtcatccacaac
ctgccaatcattgtcaagatggctgtcatcagcaaggccagtgggcagtttggactcctt
caaggaacctcagctgaaacttcaggggggttgctgatttatctaccaagagaacaggca
gcttgcttttgttctgccatcaaatcttccaagtatggagagggtgggcaggcatggatt
attggcattgtggaaaagggaaacaggactgcccagatcattgatataccttgggttatt
gaggttcaacctcgtggggccgatgtgcctactgctcttgtgtctcacaagttcagtgct
tctgaacctagctga

DBGET integrated database retrieval system