KEGG   Castor canadensis (American beaver): 109685852
Entry
109685852         CDS       T04791                                 

Gene name
Adcy4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00230  Purine metabolism
ccan01100  Metabolic pathways
ccan01522  Endocrine resistance
ccan04015  Rap1 signaling pathway
ccan04020  Calcium signaling pathway
ccan04022  cGMP-PKG signaling pathway
ccan04024  cAMP signaling pathway
ccan04062  Chemokine signaling pathway
ccan04072  Phospholipase D signaling pathway
ccan04114  Oocyte meiosis
ccan04211  Longevity regulating pathway
ccan04213  Longevity regulating pathway - multiple species
ccan04261  Adrenergic signaling in cardiomyocytes
ccan04270  Vascular smooth muscle contraction
ccan04371  Apelin signaling pathway
ccan04540  Gap junction
ccan04611  Platelet activation
ccan04713  Circadian entrainment
ccan04714  Thermogenesis
ccan04723  Retrograde endocannabinoid signaling
ccan04724  Glutamatergic synapse
ccan04725  Cholinergic synapse
ccan04727  GABAergic synapse
ccan04742  Taste transduction
ccan04750  Inflammatory mediator regulation of TRP channels
ccan04911  Insulin secretion
ccan04912  GnRH signaling pathway
ccan04913  Ovarian steroidogenesis
ccan04914  Progesterone-mediated oocyte maturation
ccan04915  Estrogen signaling pathway
ccan04916  Melanogenesis
ccan04918  Thyroid hormone synthesis
ccan04921  Oxytocin signaling pathway
ccan04923  Regulation of lipolysis in adipocytes
ccan04925  Aldosterone synthesis and secretion
ccan04926  Relaxin signaling pathway
ccan04927  Cortisol synthesis and secretion
ccan04928  Parathyroid hormone synthesis, secretion and action
ccan04934  Cushing syndrome
ccan04935  Growth hormone synthesis, secretion and action
ccan04970  Salivary secretion
ccan04971  Gastric acid secretion
ccan04972  Pancreatic secretion
ccan04976  Bile secretion
ccan05032  Morphine addiction
ccan05163  Human cytomegalovirus infection
ccan05166  Human T-cell leukemia virus 1 infection
ccan05200  Pathways in cancer
ccan05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109685852 (Adcy4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109685852 (Adcy4)
   04371 Apelin signaling pathway
    109685852 (Adcy4)
   04020 Calcium signaling pathway
    109685852 (Adcy4)
   04072 Phospholipase D signaling pathway
    109685852 (Adcy4)
   04024 cAMP signaling pathway
    109685852 (Adcy4)
   04022 cGMP-PKG signaling pathway
    109685852 (Adcy4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109685852 (Adcy4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109685852 (Adcy4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109685852 (Adcy4)
   04062 Chemokine signaling pathway
    109685852 (Adcy4)
  09152 Endocrine system
   04911 Insulin secretion
    109685852 (Adcy4)
   04923 Regulation of lipolysis in adipocytes
    109685852 (Adcy4)
   04912 GnRH signaling pathway
    109685852 (Adcy4)
   04913 Ovarian steroidogenesis
    109685852 (Adcy4)
   04915 Estrogen signaling pathway
    109685852 (Adcy4)
   04914 Progesterone-mediated oocyte maturation
    109685852 (Adcy4)
   04921 Oxytocin signaling pathway
    109685852 (Adcy4)
   04926 Relaxin signaling pathway
    109685852 (Adcy4)
   04935 Growth hormone synthesis, secretion and action
    109685852 (Adcy4)
   04918 Thyroid hormone synthesis
    109685852 (Adcy4)
   04928 Parathyroid hormone synthesis, secretion and action
    109685852 (Adcy4)
   04916 Melanogenesis
    109685852 (Adcy4)
   04925 Aldosterone synthesis and secretion
    109685852 (Adcy4)
   04927 Cortisol synthesis and secretion
    109685852 (Adcy4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109685852 (Adcy4)
   04270 Vascular smooth muscle contraction
    109685852 (Adcy4)
  09154 Digestive system
   04970 Salivary secretion
    109685852 (Adcy4)
   04971 Gastric acid secretion
    109685852 (Adcy4)
   04972 Pancreatic secretion
    109685852 (Adcy4)
   04976 Bile secretion
    109685852 (Adcy4)
  09156 Nervous system
   04724 Glutamatergic synapse
    109685852 (Adcy4)
   04727 GABAergic synapse
    109685852 (Adcy4)
   04725 Cholinergic synapse
    109685852 (Adcy4)
   04723 Retrograde endocannabinoid signaling
    109685852 (Adcy4)
  09157 Sensory system
   04742 Taste transduction
    109685852 (Adcy4)
   04750 Inflammatory mediator regulation of TRP channels
    109685852 (Adcy4)
  09149 Aging
   04211 Longevity regulating pathway
    109685852 (Adcy4)
   04213 Longevity regulating pathway - multiple species
    109685852 (Adcy4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109685852 (Adcy4)
   04714 Thermogenesis
    109685852 (Adcy4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109685852 (Adcy4)
  09165 Substance dependence
   05032 Morphine addiction
    109685852 (Adcy4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    109685852 (Adcy4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109685852 (Adcy4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109685852 (Adcy4)
   05163 Human cytomegalovirus infection
    109685852 (Adcy4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109685852 (Adcy4)
Enzymes [BR:ccan01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109685852 (Adcy4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 109685852
NCBI-ProteinID: XP_020018498
Position
Unknown
AA seq 1168 aa
MRPLLRLFLSLGLSEGVERIGKSRLCQLGAGWEAAGSAWKETGLPRGWGRRLEGARGRRE
RHCGASRAATSNPTPGPPQARGLGGGDHGPLLQPPATPQRGPLLRNLLQPESAVPAAARA
SGDRALRARGATCRRLGQRQGADLRPSLLDHCAVRFGRLLVAAGPSFPRAATAALDSSPF
GPRVGRAAGSGPWLPVHWGRGERLGPGERNGRQGMGKRPGLQLSSGIAAAHALPQVSFFL
FVIFTVYAMLPLSMRDAAAAGVTSSLSHILVLGLYLGPQPDSRPALLPQLAANMVLFLCG
NLVGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQAGQGSRPENTNNFHSLYVKRH
QGVSVLYADIVGFTRLASECSPKELVLMLNELFGKFDQIAKEHECMRIKILGDCYYCVSG
LPLSLPDHAINCVRMGLDMCRAIRKLRAATGVDINMRVGVHSGSVLCGVIGLQKWQYDVW
SHDVTLANHMEAGGVPGRVHITGATLALLAGAYAVEDVAMEHRDPYLRELGEPTYLVIDP
RAEQEEEKGTAGRLLCSLEGHKMRPSLLMTRYLESWGAAKPFAHLSHMDSPVSTSTPLPE
KALASFSPQWSLDRSRTPRGLDDELDTGDAKFFQVIEQLNSQKQWKQSKDFNLLTLFFRE
KEMEKQYRLSALPAFKYYAACTFLVFLSNFIIQMLVTNRPSALAITYSITFLLFLLLLFI
CFSEHLTRCVRKGPKMLHWLPSLSSLVTTRPGLRVALGTATILLVFTMAIASLFFLPASS
DCPFLTPNVSSMAFNLSWELPGSLPLISVPYSMHCCVLGFLSCSLFLHMSFELKLLLLLL
WLVASCSLFLYSHAWLSDCLIARLYQGSLDSRPGVLKEPKLMGTMSFFIFFFTLLVLARQ
NEYYCRLDFLWKKKLRQEQEETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYHQSY
ECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGS
TYMAATGLNATSGQDTQQDAERSCSHLGTMVEFAVALGSKLDVINKHSFNNFRLRVGLNH
GPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETAWVLQSLGYTCYSRGII
KVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3507 nt   +upstreamnt  +downstreamnt
atgaggcctttgctaaggctgtttctcagtctgggtttgagcgaaggagtggaaagaatt
gggaagtcccgtctctgccagctgggagccggctgggaggccgcaggaagtgcctggaaa
gagacgggattgcctcgaggttggggacgtaggttggaaggggctcggggcagaagagaa
aggcactgtggagccagccgggctgcaacaagtaacccaacgccgggtcctccccaggcc
cgaggattgggcggcggagaccatggcccgcttcttcagccccccgccaccccccagcga
ggacctcttctacgaaacctactacagcctgagtcagcagtacccgctgctgctcgtgct
tctggcgatcgtgctctgcgcgctcgtggcgctacttgtcgtcgcctcggccagcggcag
ggagctgacctcagaccctcgcttcttgaccactgtgctgtgcgctttgggcggcttctc
gttgctgctgggcctagcttcccgagagcagcgactgcagcgctggactcgtcccctttc
gggcctcgtgtgggccgcgctgctggctctgggccatggcttcctgttcactgggggcgt
ggtgagcgcctgggaccaggtgagaggaatggcaggcaagggatggggaagcgccctggc
ctgcagctcagctcaggcattgcagctgcccacgccctgccccaggtgtcgttttttctc
ttcgtcatcttcactgtgtatgccatgctgcctctgagcatgcgggacgctgccgccgca
ggcgtcacctcgtcgctctcacacatcctggtcctcgggctgtaccttggaccccagcca
gactcccggcctgcgctgctgccgcagctggcagcaaatatggtgttgttcctgtgtggg
aacctggtaggagcataccataaggcgctgatggaacgagcactgcgtgccacattccgg
gaggcactcagttccctgcattctcgaaggaggttggacactgagaaaaagcaccaggct
ggacaggggtcacggccagagaacacgaacaacttccacagtctctatgtcaagaggcac
caaggagtgagtgtgctgtatgctgacatcgtgggcttcacacggctggccagcgagtgt
tcccctaaggagcttgtgctcatgctcaacgaactctttggcaagtttgaccagatcgcc
aaggagcacgaatgcatgaggatcaagatcctgggagactgttactactgtgtctcaggg
ctgccactgtcactgccagaccacgccatcaactgtgtgcggatggggctggacatgtgc
agagccatcaggaaactgcgggcagccactggtgtggacatcaacatgcgtgtaggcgtg
cactcaggcagtgtgctctgcggagtcatcgggctgcagaagtggcagtacgatgtctgg
tcccatgatgtcacactggccaaccacatggaggcaggcggtgtaccaggacgagtgcac
atcacaggggctaccctggccctgcttgcaggggcttatgctgtggaggatgtagccatg
gaacaccgggacccatacctacgggaactaggggagcctacctacctggtcatcgatcct
cgggctgagcaggaggaggagaagggcaccgcaggaaggttactatgctctttggaaggc
cacaagatgcgcccatcactactgatgactcgctacctggagtcctggggtgcggccaag
ccttttgcccacctgagccacatggacagtcctgtatccacctccaccccactcccggag
aaggccctggcttccttcagcccccagtggagccttgaccggagccgcaccccccgggga
ctagatgatgagctggacactggggatgccaagttcttccaggtcattgaacagctcaac
tctcagaaacagtggaagcagtcaaaggacttcaacctactgacactcttcttcagggag
aaggagatggagaaacagtatcggctgtctgcactacccgccttcaaatactatgcagcc
tgcaccttcctggtttttctatccaacttcatcatccaaatgctggtgacaaacaggcct
tcagctctggccatcacctatagtatcacctttctcctcttcctcctcctcctcttcatc
tgcttctcagagcacctgacgaggtgtgtccggaaaggccccaagatgcttcactggctg
ccttctctatccagtctggtgaccacacggccaggactacgagtagccctgggcactgcc
actatcctcctggtcttcaccatggccattgctagcctgttcttcttaccagcatcatca
gactgtcccttcctgactcccaatgtgtcatccatggctttcaacctctcctgggagctg
cccgggtccctgcctctcatcagtgtcccatactccatgcactgctgtgtgctgggtttc
ctctcctgctccctcttcttacacatgagctttgaactgaagctgctgctgctcctgctg
tggctggtggcctcctgctccctcttcttgtactcccatgcctggctgtctgactgcctc
atcgcccgcctttatcaaggttccttggactccaggccaggagtgctgaaggagcccaag
ctgatgggaactatgtcctttttcatcttcttcttcaccctccttgtcctggctcggcag
aatgaatattactgccgcctggacttcctgtggaagaagaagctgaggcaggagcaggag
gagacagagacaatggagaaccttacgcggctgctcttggagaatgtgctccctgcacac
gtggccccccagttcattggccagaaccgacgcaatgaggacctctaccatcagtcctat
gaatgtgtttgtgtcctcttcgcctcagtccctgactttaaggagttttactctgagtcc
aacatcaaccacgaggggctggagtgtctgcggttgctcaatgagataattgctgatttt
gatgagctgctctccaaacccaagttcagtggtgtggagaaaatcaaaaccattggcagc
acctacatggcagccacaggcttaaatgccacctctggacaggacacacaacaggatgct
gagcgaagctgcagccatcttggcaccatggtggaatttgcagtggccctaggatctaag
ttggacgtcatcaataagcactcattcaacaacttccgcttgcgtgtgggattgaaccat
ggaccagtagtggcaggagtgattggggcccaaaagccacaatatgacatctggggcaac
acagtgaacgtggccagccgcatggagagtacaggagtccttggcaagatccaagtgact
gaggagacagcttgggttctgcagtccctgggctatacatgctacagcaggggtatcatc
aaagtcaaaggcaaagggcaactctgcacctacttcctgaacacagacttgacacgaact
ggacctccctcagccactctaggctga

DBGET integrated database retrieval system