KEGG   Castor canadensis (American beaver): 109686000Help
Entry
109686000         CDS       T04791                                 

Gene name
Mars
Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00450  Selenocompound metabolism
ccan00970  Aminoacyl-tRNA biosynthesis
ccan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    109686000 (Mars)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    109686000 (Mars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ccan01007]
    109686000 (Mars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ccan03016]
    109686000 (Mars)
Enzymes [BR:ccan01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     109686000 (Mars)
Amino acid related enzymes [BR:ccan01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   109686000 (Mars)
Transfer RNA biogenesis [BR:ccan03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    109686000 (Mars)
 Prokaryotic type
   Other AARSs
    109686000 (Mars)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS Anticodon_1 GST_C GST_C_2 tRNA-synt_1 GST_C_3
Motif
Other DBs
NCBI-GeneID: 109686000
NCBI-ProteinID: XP_020018748
Position
Unknown
AA seq 811 aa AA seqDB search
MRLFVSEGAPGSLPVLAAAGRARGRAELLISTVGPEECVVPFFTRPKIPVLQLDSGNYLF
STSAICRYFFLLSGWEQDDLTNQWLEWEATELQPALSIALYYLVVQGKKGEDVLGPLRRA
LTFIDHSLSRQNCPFLAGETESLADIVLWGALYPLLQDPAYLPEELGALRSWFQTLSIQE
PCQQAAETVLKQRGVLALRPYLQKQPQPQPQPNPPEGRVVSNEPEEEELATLSEEEIAMA
VTAWEKGLESLPSLRPQQKPVLPVAGERNVLITSALPYVNNVPHLGNIIGCVLSADVFAR
YSRLRQWNTLYLCGTDEYGTATETKAMEEGLTPQEICDKYHTIHADIYRWFNISFDIFGR
TTTPQQTKITQDIFQRLLARGFVLKDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGD
QCDKCGKLINAIELKKPQCKVCRSSPVVKSSQHLFLDLPKRDKDEESVDQRGERCDLSRW
FFLLFCSEYLNYEDGKFSKSRGVGVFGDMAQDTGIPADIWRFYLLYIRPEGQDSAFSWTD
MLLKNNSELLNNLGNFINRAGMFVSKFFGGYVPEMVLTLDDQRLLAHITLELQHYHQLLE
KVRIRDALRSILTISRHGNQYIQVNEPWKRIKGSEAERQRAGTVTGLAVNIAALLSVMLQ
PFMPTVSATIQAQLQLPLPACRILLTNFLCTLPAGHQIGTVSPLFQKLENDQIESLRQQF
GGGQLEESLELKAKVSPKPAVVETVTTAGPQQIQILMDEVAKQGNIVRELKAQKADKNQV
AAEVAKLLDLKKQLALAEGKPLETSKGKKKK
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgagactgttcgtgagcgagggcgccccggggagcctgccggtgctggccgcggccggg
agggcccgtggtagagcagagctgctcatcagcactgtaggcccggaagagtgtgtggtc
ccattcttcacccggcccaagatccctgtcttgcagctggatagtggcaactacctcttc
tccactagtgcaatctgccgatacttctttcttttgtctggctgggagcaagatgacctt
accaaccagtggctggaatgggaagcaacagagctgcagccagctctgtctattgccctg
tactatttagtggtacaaggcaagaagggggaagatgttcttggcccacttcggagagcc
ctgactttcattgaccacagtttgagtcgtcaaaactgccctttcctggctggggagaca
gaatccctagctgacattgttttgtggggagcattgtacccattactgcaagacccagcc
tacctccctgaggagctgggagccctacgcagctggttccagacacttagtatccaggag
ccatgtcagcaagctgcagagactgtgctgaaacagcggggtgtcctggctctccggccc
tacctccaaaagcagccccagccgcagccccagcctaatccacctgagggaagagtggtc
agcaatgagcctgaggaggaagagctggctaccctgtctgaggaggagatcgctatggct
gtgactgcttgggagaagggcctggaaagcttgccgtctcttcggccccagcagaaacca
gtgttgcctgtggctggggaaaggaatgtgctcatcaccagtgccctcccttatgtcaac
aatgtcccccaccttggaaacatcattggttgtgtgctcagtgctgatgtctttgccagg
tactctcgcctccgccagtggaataccctctatctgtgtgggacagatgagtatggtaca
gcaacagagaccaaggcaatggaggaaggtctaacacctcaggaaatctgtgacaagtat
cataccatccatgctgacatctaccgctggtttaacatctcatttgatatttttggtcgt
accaccactccacagcagactaaaataacccaagacatcttccagcggttgctggcacgg
ggttttgtgctgaaagatactgtagagcaactgcggtgtgagcactgtgcccgtttcctg
gctgaccgctttgtggagggagtgtgtcccttctgtggctatgaagaggcccggggcgac
cagtgtgacaaatgtggcaagctcatcaatgccattgaactcaagaaacctcagtgtaaa
gtctgccggtcatcccctgtagtgaagtcctcccagcacctgttcttggacttgcctaag
agggataaggatgaagagtcagtggatcagagaggggaaagatgtgatttgagcagatgg
ttctttcttcttttctgttcagagtacctgaactatgaagatgggaaattttctaagagc
cggggtgtgggagtatttggagacatggcccaggacacagggatccctgctgacatctgg
cgtttttatctgctatatattcggcctgagggccaggacagtgccttctcttggacagac
atgcttcttaagaataattctgagctgcttaacaacctgggcaactttatcaacagagct
gggatgtttgtgtctaagttttttgggggctatgtgcctgaaatggttcttacccttgat
gatcagcgtctgctggcccatatcaccctggagctccagcactatcaccaactgctggag
aaggttcggatccgggatgccttacgcagtatcctcaccatatctcgacatggtaaccaa
tacattcaggtgaatgagccttggaaacggattaaaggcagtgaggctgaaaggcagcgg
gcaggcacagtgacaggcttggcagtgaatatagctgccttgctgtctgtcatgctccag
cctttcatgcctacggttagcgccaccatccaggcccagctgcaactcccacttccagcc
tgcaggatcctcctcacaaacttcctgtgtaccttaccagcagggcaccagattggcaca
gtcagtcccctgttccaaaaattggaaaatgaccagattgaaagtttgagacagcaattt
ggagggggccagctagaagagtccttggagttaaaggcaaaagtgtctcccaagccagca
gttgtagagactgttacaacagctgggccacagcagatacaaatattgatggatgaagtg
gcaaaacagggcaacattgtccgagaactgaaagcacaaaaggcagacaagaaccaggtt
gctgcagaggtggctaaactcttggatctaaagaaacagttggctctagcagaggggaaa
ccccttgaaacttctaaaggcaagaagaaaaagtga

DBGET integrated database retrieval system