KEGG   Castor canadensis (American beaver): 109687437Help
Entry
109687437         CDS       T04791                                 

Gene name
Trmt44
Definition
(RefSeq) probable tRNA (uracil-O(2)-)-methyltransferase
  KO
K15447  tRNASer (uridine44-2'-O)-methyltransferase [EC:2.1.1.211]
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ccan03016]
    109687437 (Trmt44)
Enzymes [BR:ccan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.211  tRNASer (uridine44-2'-O)-methyltransferase
     109687437 (Trmt44)
Transfer RNA biogenesis [BR:ccan03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    109687437 (Trmt44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AdoMet_MTase
Motif
Other DBs
NCBI-GeneID: 109687437
NCBI-ProteinID: XP_020020922
Position
Unknown
AA seq 788 aa AA seqDB search
MAEVGRVQVCDPGGLLPGGFWAAVAVWLERPQVANKRLCGSRIEARRSAALPSAGPERKE
RDAAGPGPQEGPEPGQGSPERDSNSRPGLGPEHEEGAAAGRGLQEGSPEGDPDSRAGLGP
AQGTAGRGREEAQGWRPQVREQKEAAAAPPLAADPTQPPQTAGSQGEDPAANLDLIWDHF
SKSLASGNSEMLAFLTGSREGSQPEAPHELDLILRIVIPKASPHSRLTAPRREIVVQDVP
SGTATFLPLEEDVEGSVEVQMSNVYQVQLQHSEGKWFISVLIFCPERWHSEGVIYPKLTW
LAEELLAKLARWSVENKKSEFKNTLSLISVMRYSRTYQELKEKYKEMVKVWPEVTDPEKF
VYEDVAIATYLLILWEEERAERGVTAKQSFVDLGCGNGLLVHILCSEGHPGRGIDVRRRK
IWDMYGPQTQLEEGAITPGDKTLFPDADWLIGNHSDELTPWIPVITARSSYNCRFFVLPC
CFFDFTGKYCRRQSRKTQYREYLDFIQEVGLSCGFHVQEDCLRIPSTKRVCLIGKSRTYP
PTGEVWMDEQRARYIHGRRGHPVSPPGKEHSCSAPEVAAGSAGHQDSPASLGSGTECVPE
ALPAEQGAGTQAAAVWLPGFQPREKAEPVRNCATLPRDFVDQVVLQVADLLLAGKKLNTA
SSQEGSLKTWNGGGSYSLAEVASELDRETLRRLKRECGGLQTLLRNSHQVFEVLNGRVHI
RDWRQELQKEKRPAAKRSLSSEAFKTRLCWFFTHHPDGCVLPSSCCPFAHGPGELQPSQT
SQKQRQST
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtgggccgggtgcaggtgtgcgatcccggcgggctgcttccgggtggcttc
tgggcggccgtggccgtgtggctggagaggccgcaggtagccaacaagcggctatgcggc
tcccggatagaggcccgccggagcgccgccctgccaagcgcgggccccgagcggaaggag
cgggacgcggcgggacccggtccgcaggagggaccagaacccggtcagggttctcctgag
agagattctaattccaggccgggattaggacctgagcacgaggagggtgccgcggcggga
cgtggactccaggaggggtcccccgagggtgaccctgactccagggcaggattaggacct
gcgcagggcactgctggtcgtggacgcgaggaggcccagggctggcgcccccaggttagg
gagcagaaggaagcagccgcagcgcctccgctcgccgcggaccccacacagcccccacag
actgcaggcagtcaaggcgaagaccccgcagcaaatctggatttgatctgggaccatttc
tccaaaagccttgccagcggcaactcggaaatgctggccttcctcactggctctcgggag
ggatcgcaaccagaagcaccgcatgaactcgacctgattctcaggattgtcatcccgaaa
gcgagtcctcatagccgactcacagccccgaggagagaaatagtcgtgcaagatgtcccc
agtggaactgcaacgtttttgcccttggaagaagatgttgaggggagcgtagaggttcag
atgagcaatgtatatcaagtccaactccagcatagtgaaggaaagtggttcatttctgtt
ttaattttctgtccagagaggtggcattcggagggagttatatatcccaaactcacctgg
cttgcagaagagttgctggccaagttggccaggtggtctgtggagaacaagaagagcgag
tttaaaaatactctttctctcatttccgtcatgaggtacagcaggacataccaggaactt
aaagagaagtacaaagaaatggttaaggtgtggcctgaagtaactgatcctgaaaagttt
gtatatgaagatgtagctatcgctacgtacctgctgatcctatgggaagaggaaagagcc
gagaggggagtaacagccaagcagtcctttgtggacttgggctgtgggaatggtctcctg
gtccacatcctgtgcagtgaagggcacccaggcagagggattgatgtccgaagaaggaaa
atttgggacatgtatggaccccagactcagctggaggaaggtgcaatcaccccaggtgat
aagacccttttccctgacgctgactggctgattggtaaccattctgatgagctcacaccc
tggatacctgtcatcacagccaggtcttcctacaactgcaggttcttcgttctaccgtgc
tgctttttcgacttcactgggaaatactgccggaggcagagcaggaagacacagtaccgg
gaatacctggacttcatccaggaggtggggctctcctgtggcttccacgtgcaggaagac
tgcctcagaattccttccaccaagcgggtctgtctcattggaaaatccagaacataccct
cccactggagaagtctggatggatgagcagagggcccggtacattcatggcaggaggggc
catcctgtgagcccgcctggcaaggagcactcctgttctgcacctgaggttgctgctggc
agtgctggtcatcaagacagtcccgcaagcttgggttcagggactgaatgtgtgcctgag
gccttgcctgccgagcagggagcagggacccaagctgcagcagtctggcttcctggtttc
cagcctagagaaaaagctgagcccgtgaggaattgtgccaccctccctcgagactttgtt
gaccaagtggttttgcaagtggcagatttgttgttagctggaaagaagttaaacacagca
agttctcaggaagggagtttgaagacctggaatggaggagggagctattccttggctgaa
gtggccagtgagctagacagggagaccctgagaaggctgaagcgggagtgtggaggcctg
cagacactgctcaggaacagccaccaagtgtttgaagttctgaatgggcgagttcacatt
cgagactggaggcaagagctacagaaggagaagcgacctgcagccaagcggagcctgtct
tcagaggctttcaagacccgcctctgttggtttttcactcaccatcctgatggctgtgtg
ctgccttcctcctgctgtccatttgctcatgggcctggggagctgcagccatcccagacc
tcccagaagcagagacagagcacgtga

DBGET integrated database retrieval system