KEGG   Castor canadensis (American beaver): 109688198Help
Entry
109688198         CDS       T04791                                 

Definition
(RefSeq) dual specificity protein phosphatase 10
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109688198
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccan01009]
    109688198
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109688198
    3.1.3.48  protein-tyrosine-phosphatase
     109688198
Protein phosphatases and associated proteins [BR:ccan01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    109688198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese PTPlike_phytase Y_phosphatase Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 109688198
NCBI-ProteinID: XP_020022082
Position
Unknown
AA seq 482 aa AA seqDB search
MPPTPLDDRVVVALSRPVRPQDLNLCLDSGYLGSATPGSSSHPPVIATTVVPLKAANLTY
MPSPSGSARSLNCGCSSASCCTVATYDKDNQAQTQAIATGTATTAIGTSTTCSANQMVNN
NENTGSLSPSGGVGSPVSGTPKQLASIKIIYPNDLAKKMTKCSKSHLPSQGPVIIDCRPF
MEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENT
NEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQSHENLCDNSLQLQECREVGGSA
SAASSMLPQSVPTTPDIENAELTPILPFLFLGNEQDAQDLDTMQRLNIGYVINVTTHLPL
YHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVI
AYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLIGVET
VV
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcctccgactcctttagacgacagggtagtagtggcactgtctaggcctgtccgacct
caggatctcaacctttgtttagactctggctaccttggctctgccaccccaggcagtagt
agccaccctcctgtcattgccaccaccgttgtgcccctcaaggctgcgaatctgacgtat
atgccctcacccagcggctctgcccgctccctgaattgtggatgcagcagtgccagctgc
tgcactgtggcaacctacgacaaggacaatcaggcccagacccaagccattgccactggc
actgccaccactgccattggaacctctaccacctgctctgctaaccagatggtcaacaac
aatgagaatacaggctctttaagtccatcaggtggggtgggcagccctgtgtcagggacc
cccaagcagctagccagcatcaaaatcatctaccccaatgacttggcgaagaagatgacc
aaatgcagcaaaagtcacctgcccagccagggccctgtcatcattgactgcaggcccttc
atggagtacaacaagagtcacatccaaggagctgtccacattaactgtgccgataagatc
agccgacggagactgcagcagggcaagatcactgtcctggacttgatttcctgtagggaa
ggcaaggactctttcaagaggatcttttccaaagaaattatagtttatgatgagaatacc
aatgagccgagccgagtgatgccctcccagccgcttcacatagttctcgagtccctgaag
agagaaggcaaagaacctctggtgttgaaaggtggacttagtagttttaagcagagccat
gaaaacctctgtgacaactccctccagctccaagagtgcagggaggttgggggcagtgca
tctgcggcctcgagcatgctacctcagtctgtccccaccacccctgacatcgagaacgca
gagctgacgcccatcctgcccttcctgttccttggcaacgagcaggatgctcaggacctg
gacaccatgcagcggctgaacattggctatgtcatcaatgtcaccactcaccttcctttg
taccactacgagaaaggcctcttcaactataagcggctgccagccactgacagcaacaag
cagaacctgcggcagtactttgaagaggcttttgagttcattgaggaagctcaccagtgt
gggaaagggcttctcatccactgccaggctggcgtgtcccgctctgccaccattgtcatc
gcctacttgatgaaacacacacgaatgaccatgactgatgcttacaaatttgtcaaaggc
aaacgaccaattatttccccaaaccttaacttcatggggcaattgctggagtttgaggaa
gacctaaacaatggtgtaacaccacgaatccttacaccaaagctgattggcgtggagact
gttgtgtga

DBGET integrated database retrieval system