KEGG   Castor canadensis (American beaver): 109688360Help
Entry
109688360         CDS       T04791                                 

Definition
(RefSeq) succinate-semialdehyde dehydrogenase, mitochondrial-like
  KO
K00139  succinate-semialdehyde dehydrogenase [EC:1.2.1.24]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00250  Alanine, aspartate and glutamate metabolism
ccan00650  Butanoate metabolism
ccan01100  Metabolic pathways
Module
ccan_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109688360
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109688360
Enzymes [BR:ccan01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     109688360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 109688360
NCBI-ProteinID: XP_020022277
Position
Unknown
AA seq 473 aa AA seqDB search
MLSCTAFAPSENHRPKSYVLWSCSKKRDGGPWQPRQAPAHLGTERKLLGQGIPSWGNKRE
RAILLQQMRSEVATDKLAPERGKGDGRPKCVWPRAFPIRTPASPGEGRAPSKPSRAQDKV
QGLAPQCSTASAGRGRCSATFTAVLRHPARPRRLLIPPASPQPLRSRARLLACLLPAAVA
ATAAPAMATCFWLRSCGAPRLLLAPPGRRLRPCADCLRPTVGPTPGRAQLRSYARGPAGL
STELLRTDSFVGGRWLPAAATFPVHDPASGAALGMVADCGVPEARAAVQTAYEAFCSWRG
VSVKERSSLLRKWYDLMIQNKDDLAKIITAESGKPLKEAQAEILYSALFLEWFSEEARRI
YGDIIPMSPKEKRALVFKQPIGVAAIITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTP
FSALALAQVSLSLCVCRQPTTSMSGCLSGAERGSFGASVIACISCVLPRFNRL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgctgagctgcacagcgttcgccccctcagaaaaccatcgccccaaatcctacgtgctc
tggagctgcagcaagaaacgtgatggtgggccttggcagccgaggcaggcaccagctcac
ctgggcaccgagcgcaaattgctggggcaggggataccctcttgggggaataagagggaa
agggcgattctcctgcagcagatgcgaagcgaagtagctacagacaaattagcccccgag
agggggaaaggtgatggccgtcccaagtgcgtctggccaagagccttccccattcgcacc
ccagcctccccgggagaaggtcgtgcaccgagcaagccttcccgcgctcaggacaaggtc
caaggtctggcgccacagtgcagcaccgcgagcgcggggagggggcgctgctccgcaacc
ttcaccgctgtcctccgccaccccgcgcggccccgccgccttctcattcctccagcttcc
ccgcaacccctgcgctcccgtgcgcgcttgcttgcttgcctgcttcctgccgctgtcgcc
gccaccgctgccccggccatggccacctgcttttggctgcggagctgcggggccccacgc
ctcctactggcgcctcctggccgtcgccttcgcccctgcgcggactgcttaaggcccaca
gttgggcccacgcccggccgggcccagctccgcagctatgccaggggcccggccggcctc
tccacagagctgctgcgcaccgacagcttcgtgggtggccgctggctcccggccgctgcc
accttcccagtgcacgatcccgccagcggcgctgcgctgggcatggtggccgactgcggg
gtgcccgaggcccgcgccgccgtgcaaaccgcctacgaggccttctgcagctggaggggg
gtctcggtcaaggagaggagttcattacttcggaaatggtacgatttaatgatacaaaat
aaggacgaccttgcaaaaataatcactgccgagagtggaaagccactgaaggaggcacag
gcagaaattctttattccgcccttttcctagagtggttttcagaggaagcccgccgcatt
tatggagatattatccctatgtccccaaaggaaaagcgggccctggtcttcaaacagccc
attggtgtggccgccatcatcacaccgtggaattttcccagcgccatgatcacccggaag
gtgggggccgccctggcagccggctgcactgtggtggtgaaacctgctgaagacacgccc
ttctccgccctggccctggcccaggtgagcctctctttgtgtgtttgtagacagccaacc
acgtccatgagtggatgtttatcaggggcagaaaggggcagttttggagcctccgtgatt
gcctgcatctcctgtgtgctaccacgttttaaccgactg

DBGET integrated database retrieval system